|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1320 details | |
AVPid | AVP1320 |
Sequence | NIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLM |
Nomenclature | T-152 |
Length | 35 |
Against virus | Respiratory syncytial virus (RSV) |
Virus Family | Paramyxoviridae |
Source | RSV fusion (F) protein |
Uniprot | P03420 |
Cell line | Vero |
Inhibition/IC50 | Nil |
Unit |
- |
Target | Fusion |
Assay | Immunoprecipitation |
Properties | View |
Structure | Jmol |
Paper | Methods for the inhibition of respiratory syncytial virus transmission |
Authors | Dani Paul Bolognesi, Thomas James Matthews, Carl T. Wild, Shawn O'Lin Barney,Dennis Michael Lambert, Stephen Robert Petteway |
Reference | Trimeris, Inc., Durham NC |
Accession | US6440656 |