 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1329 details | |
| AVPid | AVP1329 |
| Sequence | DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL |
| Nomenclature | T-109 |
| Length | 35 |
| Against virus | Respiratory syncytial virus (RSV) |
| Virus Family | Paramyxoviridae |
| Source | RSV fusion (F) protein |
| Uniprot | P03420 |
| Cell line | Vero |
| Inhibition/IC50 | High |
| Unit |
- |
| Target | Fusion |
| Assay | Immunoprecipitation |
| Properties | View |
| Structure | Jmol |
| Paper | Methods for the inhibition of respiratory syncytial virus transmission |
| Authors | Dani Paul Bolognesi, Thomas James Matthews, Carl T. Wild, Shawn O'Lin Barney,Dennis Michael Lambert, Stephen Robert Petteway |
| Reference | Trimeris, Inc., Durham NC |
| Accession | US6440656 |