|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1373 details | |
AVPid | AVP1373 |
Sequence | LNNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ |
Nomenclature | Sequenece No:34 |
Length | 35 |
Against virus | Human parainfluenza virus type 3 (HPIV 3) |
Virus Family | Paramyxoviridae |
Source | HPIV3 fusion (F) protein |
Uniprot | P06828 |
Cell line | - |
Inhibition/IC50 | High |
Unit |
- |
Target | Hemagglutinin-Neuraminidase |
Assay | Cell-fusion assay |
Properties | View |
Structure | Jmol |
Paper | Methods and compositions for inhibition of membrane fusion-associated events |
Authors | Shawn O'Lin, Dennis Michael, Stephen Robert |
Reference | Trimeris, Inc., Durham NC (US) |
Accession | US6951717 |