 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1374 details | |
| AVPid | AVP1374 |
| Sequence | NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK |
| Nomenclature | Sequenece No:35 |
| Length | 35 |
| Against virus | Human parainfluenza virus type 3 (HPIV 3) |
| Virus Family | Paramyxoviridae |
| Source | HPIV3 fusion (F) protein |
| Uniprot | P06828 |
| Cell line | - |
| Inhibition/IC50 | High |
| Unit |
- |
| Target | Hemagglutinin-Neuraminidase |
| Assay | Cell-fusion assay |
| Properties | View |
| Structure | Jmol |
| Paper | Methods and compositions for inhibition of membrane fusion-associated events |
| Authors | Shawn O'Lin, Dennis Michael, Stephen Robert |
| Reference | Trimeris, Inc., Durham NC (US) |
| Accession | US6951717 |