 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1490 details | |
AVPid | AVP1490 |
Sequence | YKFACPECPKRFMRSDHLSKHITLHELLGEERR |
Nomenclature | - |
Length | 33 |
Against virus | Human papillomavirus (HPV) |
Virus Family | Papillomaviridae |
Source | E6-associated protein (E6AP) |
Uniprot | Q05086 |
Cell line | - |
Inhibition/IC50 | 19.3±2.9 |
Unit |
μM |
Target | E6 protein |
Assay | CD spectroscopy |
Properties | View |
Structure | Jmol |
Paper | Design and characterization of helical peptides that inhibit the E6 protein of papillomavirus. |
Authors | Liu Y, Liu Z, Androphy E, Chen J, Baleja JD. |
Reference | Biochemistry. 2004 |
Accession | 15182185 |