 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1490 details | |
|---|
| AVPid | AVP1490 |
| Sequence | YKFACPECPKRFMRSDHLSKHITLHELLGEERR |
| Nomenclature | - |
| Length | 33 |
| Against virus | Human papillomavirus (HPV) |
| Virus Family | Papillomaviridae |
| Source | E6-associated protein (E6AP) |
| Uniprot | Q05086 |
| Cell line | - |
| Inhibition/IC50 | 19.3±2.9 |
| Unit |
μM |
| Target | E6 protein |
| Assay | CD spectroscopy |
| Properties | View |
| Structure | Jmol |
| Paper | Design and characterization of helical peptides that inhibit the E6 protein of papillomavirus. |
| Authors | Liu Y, Liu Z, Androphy E, Chen J, Baleja JD. |
| Reference | Biochemistry. 2004 |
| Accession | 15182185 |