 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1554 details | |
|---|
| AVPid | AVP1554 |
| Sequence | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Nomenclature | HBD1 |
| Length | 36 |
| Against virus | BK virus (BKV) |
| Virus Family | Polyomaviridae |
| Source | Human alpha defensin |
| Uniprot | P60022 |
| Cell line | Vero |
| Inhibition/IC50 | 5 |
| Unit |
% |
| Target | Virus entry |
| Assay | Flow cytometry |
| Properties | View |
| Structure | Jmol |
| Paper | Human alpha-defensins inhibit BK virus infection by aggregating virions and blocking binding to host cells. |
| Authors | Dugan AS, Maginnis MS, Jordan JA, Gasparovic ML, Manley K, Page R, Williams G, Porter E, O'Hara BA, Atwood WJ. |
| Reference | J Biol Chem. 2008 |
| Accession | 18782756 |