 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1555 details | |
AVPid | AVP1555 |
Sequence | DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKP |
Nomenclature | HBD2 |
Length | 37 |
Against virus | BK virus (BKV) |
Virus Family | Polyomaviridae |
Source | Human alpha defensin |
Uniprot | Q9TT12 |
Cell line | Vero |
Inhibition/IC50 | 45 |
Unit |
% |
Target | Virus entry |
Assay | Flow cytometry |
Properties | View |
Structure | Jmol |
Paper | Human alpha-defensins inhibit BK virus infection by aggregating virions and blocking binding to host cells. |
Authors | Dugan AS, Maginnis MS, Jordan JA, Gasparovic ML, Manley K, Page R, Williams G, Porter E, O'Hara BA, Atwood WJ. |
Reference | J Biol Chem. 2008 |
Accession | 18782756 |