|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1563 details | |
AVPid | AVP1563 |
Sequence | VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSD |
Nomenclature | - |
Length | 36 |
Against virus | Hendra Virus (HeV) |
Virus Family | Paramyxoviridae |
Source | HPIV3 fusion (F) protein |
Uniprot | P06828 |
Cell line | HeLa |
Inhibition/IC50 | 8000 |
Unit |
nM |
Target | Fusion |
Assay | Luminescence fusion assay |
Properties | View |
Structure | Jmol |
Paper | Inhibition of hendra virus fusion. |
Authors | Porotto M, Doctor L, Carta P, Fornabaio M, Greengard O, Kellogg GE, Moscona A. |
Reference | J Virol. 2006 |
Accession | 16973588 |