 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1568 details | |
| AVPid | AVP1568 |
| Sequence | VYTDKVDISSQISSMNQSLQQSKDYIKEAQKILDTV |
| Nomenclature | - |
| Length | 36 |
| Against virus | Human parainfluenza virus type 3 (HPIV 3) |
| Virus Family | Paramyxoviridae |
| Source | HeV fusion (F) protein |
| Uniprot | O89342 |
| Cell line | HeLa |
| Inhibition/IC50 | >10^4 |
| Unit |
nM |
| Target | Fusion |
| Assay | Luminescence fusion assay |
| Properties | View |
| Structure | Jmol |
| Paper | Inhibition of hendra virus fusion. |
| Authors | Porotto M, Doctor L, Carta P, Fornabaio M, Greengard O, Kellogg GE, Moscona A. |
| Reference | J Virol. 2006 |
| Accession | 16973588 |