 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1577 details | |
|---|
| AVPid | AVP1577 |
| Sequence | KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL |
| Nomenclature | NiV FC2 |
| Length | 37 |
| Against virus | Hendra Virus (HeV) |
| Virus Family | Paramyxoviridae |
| Source | NiV fusion glycoprotein |
| Uniprot | Q9IH63 |
| Cell line | HeLa |
| Inhibition/IC50 | 17.59 |
| Unit |
nM |
| Target | Fusion |
| Assay | Immunofluorescence |
| Properties | View |
| Structure | Jmol |
| Paper | Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein. |
| Authors | Bossart KN, Mungall BA, Crameri G, Wang LF, Eaton BT, Broder CC. |
| Reference | Virol J. 2005 |
| Accession | 16026621 |