|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1578 details | |
AVPid | AVP1578 |
Sequence | KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL |
Nomenclature | NiV FC2 |
Length | 37 |
Against virus | Nipah virus (NiV) |
Virus Family | Paramyxoviridae |
Source | NiV fusion glycoprotein |
Uniprot | Q9IH63 |
Cell line | HeLa |
Inhibition/IC50 | 13.08 |
Unit |
nM |
Target | Fusion |
Assay | Immunofluorescence |
Properties | View |
Structure | Jmol |
Paper | Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein. |
Authors | Bossart KN, Mungall BA, Crameri G, Wang LF, Eaton BT, Broder CC. |
Reference | Virol J. 2005 |
Accession | 16026621 |