|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1592 details | |
AVPid | AVP1592 |
Sequence | GSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE |
Nomenclature | delta13-48-Fc |
Length | 36 |
Against virus | Ebola virus (EBoV) |
Virus Family | Filoviridae |
Source | EboV delta peptide |
Uniprot | Q7T9E0 |
Cell line | Vero E6 |
Inhibition/IC50 | High |
Unit |
- |
Target | Virus entry |
Assay | Flow cytometry |
Properties | View |
Structure | Jmol |
Paper | Ebolavirus delta-peptide immunoadhesins inhibit marburgvirus and ebolavirus cell entry. |
Authors | Radoshitzky SR, Warfield KL, Chi X, Dong L, Kota K, Bradfute SB, Gearhart JD, Retterer C, Kranzusch PJ, Misasi JN, Hogenbirk MA, Wahl-Jensen V, Volchkov VE, Cunningham JM, Jahrling PB, Aman MJ, Bavari S, Farzan M, Kuhn JH. |
Reference | J Virol. 2011 |
Accession | 21697477 |