 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1592 details | |
| AVPid | AVP1592 |
| Sequence | GSIRTWFQRIPLGWFHCTYQKGKQHCRLRIRQKVEE |
| Nomenclature | delta13-48-Fc |
| Length | 36 |
| Against virus | Ebola virus (EBoV) |
| Virus Family | Filoviridae |
| Source | EboV delta peptide |
| Uniprot | Q7T9E0 |
| Cell line | Vero E6 |
| Inhibition/IC50 | High |
| Unit |
- |
| Target | Virus entry |
| Assay | Flow cytometry |
| Properties | View |
| Structure | Jmol |
| Paper | Ebolavirus delta-peptide immunoadhesins inhibit marburgvirus and ebolavirus cell entry. |
| Authors | Radoshitzky SR, Warfield KL, Chi X, Dong L, Kota K, Bradfute SB, Gearhart JD, Retterer C, Kranzusch PJ, Misasi JN, Hogenbirk MA, Wahl-Jensen V, Volchkov VE, Cunningham JM, Jahrling PB, Aman MJ, Bavari S, Farzan M, Kuhn JH. |
| Reference | J Virol. 2011 |
| Accession | 21697477 |