![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP1748 details | |
AVPid | AVP1748 |
Sequence | FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG |
Nomenclature | AvBD16 |
Length | 50 |
Against virus | Duck hepaptitis virus (DHV) |
Virus Family | Picornaviridae |
Source | Duck beta defensin |
Uniprot | Q9DG58 |
Cell line | Duck embryo |
Inhibition/IC50 | High |
Unit |
- |
Target | Replication |
Assay | Neutralization assay |
Properties | View |
Structure | Jmol |
Paper | Identification, expression and activity analyses of five novel duck beta-defensins. |
Authors | Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S. |
Reference | PLoS One. 2012 |
Accession | 23112840 |