 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1769 details | |
| AVPid | AVP1769 |
| Sequence | RARRSLLIASALCTSDVAAATNADLRTALARADHQKTLFWL |
| Nomenclature | H-HR2 |
| Length | 41 |
| Against virus | Herpes simplex virus 1 (HSV 1) |
| Virus Family | Herpesviridae |
| Source | HSV-1 H glycoprotein (gH) |
| Uniprot | Q9DHD5 |
| Cell line | Vero |
| Inhibition/IC50 | 40 |
| Unit |
% |
| Target | Virus entry |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Analysis of synthetic peptides from heptad-repeat domains of herpes simplex virus type 1 glycoproteins H and B. |
| Authors | Galdiero S, Vitiello M, D'Isanto M, Falanga A, Collins C, Raieta K, Pedone C, Browne H, Galdiero M. |
| Reference | J Gen Virol. 2006 |
| Accession | 16603508 |