![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP1769 details | |
AVPid | AVP1769 |
Sequence | RARRSLLIASALCTSDVAAATNADLRTALARADHQKTLFWL |
Nomenclature | H-HR2 |
Length | 41 |
Against virus | Herpes simplex virus 1 (HSV 1) |
Virus Family | Herpesviridae |
Source | HSV-1 H glycoprotein (gH) |
Uniprot | Q9DHD5 |
Cell line | Vero |
Inhibition/IC50 | 40 |
Unit |
% |
Target | Virus entry |
Assay | Plaque assay |
Properties | View |
Structure | Jmol |
Paper | Analysis of synthetic peptides from heptad-repeat domains of herpes simplex virus type 1 glycoproteins H and B. |
Authors | Galdiero S, Vitiello M, D'Isanto M, Falanga A, Collins C, Raieta K, Pedone C, Browne H, Galdiero M. |
Reference | J Gen Virol. 2006 |
Accession | 16603508 |