 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1777 details | |
| AVPid | AVP1777 |
| Sequence | TKKNSFKRKSIMLPKSLLSVVKSATLETKPESKYS |
| Nomenclature | IFNGR |
| Length | 35 |
| Against virus | Encephalomyocarditis virus (ECMV) |
| Virus Family | Picornaviridae |
| Source | Gamma interferon (IFN-gamma) |
| Uniprot | P15261 |
| Cell line | L929 |
| Inhibition/IC50 | Low |
| Unit |
- |
| Target | Immunostimulaton |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | The gamma interferon (IFN-gamma) mimetic peptide IFN-gamma (95-133) prevents encephalomyocarditis virus infection both in tissue culture and in mice. |
| Authors | Mujtaba MG, Patel CB, Patel RA, Flowers LO, Burkhart MA, Waiboci LW, Martin J, Haider MI, Ahmed CM, Johnson HM. |
| Reference | Clin Vaccine Immunol. 2006 |
| Accession | 16893996 |