 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1803 details | |
| AVPid | AVP1803 |
| Sequence | VVTTRLFMSLVASVRNAFQSGYISFDEIIKTE |
| Nomenclature | gHH2 |
| Length | 32 |
| Against virus | Marek's disease virus (MDV) |
| Virus Family | Herpesviridae |
| Source | MDV H glycoprotein (gH) |
| Uniprot | Q9E6P6 |
| Cell line | CEF |
| Inhibition/IC50 | 8±0.24 |
| Unit |
μM |
| Target | Virus entry |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Structural characteristics and antiviral activity of multiple peptides derived from MDV glycoproteins B and H. |
| Authors | Wang X, Chi X, Wang M. |
| Reference | Virol J. 2011 |
| Accession | 21518442 |