|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1803 details | |
AVPid | AVP1803 |
Sequence | VVTTRLFMSLVASVRNAFQSGYISFDEIIKTE |
Nomenclature | gHH2 |
Length | 32 |
Against virus | Marek's disease virus (MDV) |
Virus Family | Herpesviridae |
Source | MDV H glycoprotein (gH) |
Uniprot | Q9E6P6 |
Cell line | CEF |
Inhibition/IC50 | 8±0.24 |
Unit |
μM |
Target | Virus entry |
Assay | Plaque assay |
Properties | View |
Structure | Jmol |
Paper | Structural characteristics and antiviral activity of multiple peptides derived from MDV glycoproteins B and H. |
Authors | Wang X, Chi X, Wang M. |
Reference | Virol J. 2011 |
Accession | 21518442 |