 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1815 details | |
| AVPid | AVP1815 |
| Sequence | PEDQFNVALDQVFESIENSQALVDQSNRILSSAEKGNTG |
| Nomenclature | HRB6 |
| Length | 39 |
| Against virus | Human metapneumovirus (hMPV) |
| Virus Family | Paramyxoviridae |
| Source | hMPV fusion (F) protein |
| Uniprot | Q6WB98 |
| Cell line | LLC-MK2 |
| Inhibition/IC50 | 3310 |
| Unit |
nM |
| Target | Virus entry |
| Assay | RT PCR |
| Properties | View |
| Structure | Jmol |
| Paper | Identification and evaluation of a highly effective fusion inhibitor for human metapneumovirus. |
| Authors | Deffrasnes C, Hamelin ME, Prince GA, Boivin G. |
| Reference | Antimicrob Agents Chemother. 2008 |
| Accession | 17967906 |