 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1815 details | |
AVPid | AVP1815 |
Sequence | PEDQFNVALDQVFESIENSQALVDQSNRILSSAEKGNTG |
Nomenclature | HRB6 |
Length | 39 |
Against virus | Human metapneumovirus (hMPV) |
Virus Family | Paramyxoviridae |
Source | hMPV fusion (F) protein |
Uniprot | Q6WB98 |
Cell line | LLC-MK2 |
Inhibition/IC50 | 3310 |
Unit |
nM |
Target | Virus entry |
Assay | RT PCR |
Properties | View |
Structure | Jmol |
Paper | Identification and evaluation of a highly effective fusion inhibitor for human metapneumovirus. |
Authors | Deffrasnes C, Hamelin ME, Prince GA, Boivin G. |
Reference | Antimicrob Agents Chemother. 2008 |
Accession | 17967906 |