 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1829 details | |
| AVPid | AVP1829 |
| Sequence | NEELGKKYEETKKKQEEFYKKIEEIEKKNEEVKKKLEELQKK |
| Nomenclature | FIV-C35EK2 |
| Length | 42 |
| Against virus | Feline immunodeficiency virus (FIV) |
| Virus Family | Retroviridae |
| Source | FIV envelope glycoprotein (gp40) |
| Uniprot | Q04995 |
| Cell line | HeLa |
| Inhibition/IC50 | Nil |
| Unit |
- |
| Target | Virus entry |
| Assay | Syncitia assay |
| Properties | View |
| Structure | Jmol |
| Paper | Antiviral activity of membrane fusion inhibitors that target gp40 of the feline immunodeficiency virus envelope protein. |
| Authors | Mizukoshi F, Baba K, Goto Y, Setoguchi A, Fujino Y, Ohno K, Oishi S, Kodera Y, Fujii N, Tsujimoto H. |
| Reference | Vet Microbiol. 2009 |
| Accession | 19036536 |