|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1829 details | |
AVPid | AVP1829 |
Sequence | NEELGKKYEETKKKQEEFYKKIEEIEKKNEEVKKKLEELQKK |
Nomenclature | FIV-C35EK2 |
Length | 42 |
Against virus | Feline immunodeficiency virus (FIV) |
Virus Family | Retroviridae |
Source | FIV envelope glycoprotein (gp40) |
Uniprot | Q04995 |
Cell line | HeLa |
Inhibition/IC50 | Nil |
Unit |
- |
Target | Virus entry |
Assay | Syncitia assay |
Properties | View |
Structure | Jmol |
Paper | Antiviral activity of membrane fusion inhibitors that target gp40 of the feline immunodeficiency virus envelope protein. |
Authors | Mizukoshi F, Baba K, Goto Y, Setoguchi A, Fujino Y, Ohno K, Oishi S, Kodera Y, Fujii N, Tsujimoto H. |
Reference | Vet Microbiol. 2009 |
Accession | 19036536 |