 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1848 details | |
|---|
| AVPid | AVP1848 |
| Sequence | GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA |
| Nomenclature | HLFcin 1-49 |
| Length | 49 |
| Against virus | Human papillomavirus (HPV) |
| Virus Family | Papillomaviridae |
| Source | Human lactoferrin |
| Uniprot | P02788 |
| Cell line | HaCaT |
| Inhibition/IC50 | 16±7.4 |
| Unit |
μM |
| Target | Virus entry |
| Assay | Western blotting |
| Properties | View |
| Structure | Jmol |
| Paper | The anti-papillomavirus activity of human and bovine lactoferricin. |
| Authors | Mistry N, Drobni P, Naslund J, Sunkari VG, Jenssen H, Evander M. |
| Reference | Antiviral Res. 2007 |
| Accession | 17481742 |