|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1881 details | |
AVPid | AVP1881 |
Sequence | IDRLNEVAKNLNESLIDLQELGKYEQYIKWPW |
Nomenclature | HR2-20 |
Length | 32 |
Against virus | SARS coronavirus (SARS-CoV) |
Virus Family | Coronaviridae |
Source | SARS-CoV spike protein |
Uniprot | P59594 |
Cell line | 293T |
Inhibition/IC50 | Low |
Unit |
NA |
Target | Virus entry |
Assay | Luciferase assay |
Properties | View |
Structure | Jmol |
Paper | Suppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein. |
Authors | Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H. |
Reference | Biochem Biophys Res Commun. 2004 |
Accession | 15184046 |