 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1922 details | |
|---|
| AVPid | AVP1922 |
| Sequence | [LL-37, 37 aa] |
| Nomenclature | LL-37 |
| Length | 37 |
| Against virus | Vaccinia (VACV) |
| Virus Family | Poxviridae |
| Source | Human cathelicidin |
| Uniprot | P49913 |
| Cell line | BSC-1 |
| Inhibition/IC50 | High |
| Unit |
NA |
| Target | Replication |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Selective killing of vaccinia virus by LL-37: implications for eczema vaccinatum. |
| Authors | Howell MD, Jones JF, Kisich KO, Streib JE, Gallo RL, Leung DY. |
| Reference | J Immunol. 2004 |
| Accession | 14734759 |