|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1971 details | |
AVPid | AVP1971 |
Sequence | AVSKVLHLEGEVNKISALLSTNKAVVSLSNGVSVLTSKVLDLDNYIDKQLLPIVNK |
Nomenclature | HR1-30a |
Length | 56 |
Against virus | Respiratory syncytial virus (RSV) |
Virus Family | Paramyxoviridae |
Source | RSV fusion (F) protein |
Uniprot | P03420 |
Cell line | Hep2 |
Inhibition/IC50 | 1.68 |
Unit |
μM |
Target | Fusion |
Assay | Cell-fusion assay |
Properties | View |
Structure | Jmol |
Paper | Both heptad repeats of human respiratory syncytial virus fusion protein are potent inhibitors of viral fusion. |
Authors | Wang E, Sun X, Qian Y, Zhao L, Tien P, Gao GF. |
Reference | Biochem Biophys Res Commun. 2003 |
Accession | 12615056 |