 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1972 details | |
| AVPid | AVP1972 |
| Sequence | NFYDPLVFPSDEFDASISQVNEKINQSLASIRKSDELLHNVNAGK |
| Nomenclature | HR2-30a |
| Length | 45 |
| Against virus | Respiratory syncytial virus (RSV) |
| Virus Family | Paramyxoviridae |
| Source | RSV fusion (F) protein |
| Uniprot | P03420 |
| Cell line | Hep2 |
| Inhibition/IC50 | 2.93 |
| Unit |
μM |
| Target | Fusion |
| Assay | Cell-fusion assay |
| Properties | View |
| Structure | Jmol |
| Paper | Both heptad repeats of human respiratory syncytial virus fusion protein are potent inhibitors of viral fusion. |
| Authors | Wang E, Sun X, Qian Y, Zhao L, Tien P, Gao GF. |
| Reference | Biochem Biophys Res Commun. 2003 |
| Accession | 12615056 |