 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1991 details | |
|---|
| AVPid | AVP1991 |
| Sequence | CRFPNITNSHVPILQERPPLENRVLTGWGL |
| Nomenclature | P-400 |
| Length | 30 |
| Against virus | Human T-cell leukaemia virus 1 (HTLV 1) |
| Virus Family | Retroviridae |
| Source | HTLV-1 envelope glycoprotein (gp21) |
| Uniprot | P03381 |
| Cell line | MT2 |
| Inhibition/IC50 | 3.9 |
| Unit |
μM |
| Target | Virus entry |
| Assay | Syncitia assay |
| Properties | View |
| Structure | Jmol |
| Paper | An antiviral peptide targets a coiled-coil domain of the human T-cell leukemia virus envelope glycoprotein. |
| Authors | Pinon JD, Kelly SM, Price NC, Flanagan JU, Brighty DW. |
| Reference | J Virol. 2003 |
| Accession | 12584351 |