|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1991 details | |
AVPid | AVP1991 |
Sequence | CRFPNITNSHVPILQERPPLENRVLTGWGL |
Nomenclature | P-400 |
Length | 30 |
Against virus | Human T-cell leukaemia virus 1 (HTLV 1) |
Virus Family | Retroviridae |
Source | HTLV-1 envelope glycoprotein (gp21) |
Uniprot | P03381 |
Cell line | MT2 |
Inhibition/IC50 | 3.9 |
Unit |
μM |
Target | Virus entry |
Assay | Syncitia assay |
Properties | View |
Structure | Jmol |
Paper | An antiviral peptide targets a coiled-coil domain of the human T-cell leukemia virus envelope glycoprotein. |
Authors | Pinon JD, Kelly SM, Price NC, Flanagan JU, Brighty DW. |
Reference | J Virol. 2003 |
Accession | 12584351 |