 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP2022 details | |
|---|
| AVPid | AVP2022 |
| Sequence | LNLADATNFLQDSKAELEKARKILSEVGRWY |
| Nomenclature | SV-465 |
| Length | 31 |
| Against virus | Sendai virus (SeV) |
| Virus Family | Paramyxoviridae |
| Source | SeV fusion protein |
| Uniprot | P04855 |
| Cell line | RBCs |
| Inhibition/IC50 | 80 |
| Unit |
% |
| Target | Fusion |
| Assay | Hemolysis assay |
| Properties | View |
| Structure | Jmol |
| Paper | Structure-function study of a heptad repeat positioned near the transmembrane domain of Sendai virus fusion protein which blocks virus-cell fusion. |
| Authors | Ghosh JK, Peisajovich SG, Ovadia M, Shai Y. |
| Reference | J Biol Chem. 1998 |
| Accession | 9765238 |