Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 1564| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2184 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2185 | KCFQWQRNMRKVRGPPVSCIKR | hLF R13A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2186 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7A/V12R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2187 | KCFQWQRNMRKVRGPPVSCIKR | hLF R13A/P15R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2188 | KCFQWQRNMRKVRGPPVSCIKR | hLF +4R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2189 | KCFQWQRNMRKVRGPPVSCIKR | hLF lin+4R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2190 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2191 | KCFQWQRNMRKVRGPPVSCIKR | hLF K7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2193 | GRGDSPRR | Pep1 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2194 | GRGDSPRRSPRR | Pep2 | 12 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2195 | GRGDSPRRKKKKSPRRKKKKSPRR | Pep3 | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2196 | GRGDGPRRKKKKGPRRKKKKGPRR | Pep3(Mutant) | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid (Plasmid DNA) | 24462902 |
| 2197 | LLKLLKKLLKLLKKLLKLL | PF20 | 19 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2198 | WLKLLKKWLKLWKKLLKLW | PF21 | 19 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2199 | FLKLLKKFLKLFKKLLKLF | PF22 | 19 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2205 | WLKLWKKWLKLW | PF28 | 12 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2206 | KALKLKLALALLAKLKLA | NAP | 18 | L | Linear | Synthetic | Non-Amphipathic | Free | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2207 | KALKLKLALALLAKLKLA | Stearyl-NAP | 18 | L | Linear | Synthetic | Non-Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2208 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2209 | RWRRWWRRW | RW9 | 9 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2210 | RRWRRWWRRWWRRWRR | RW16 | 16 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2215 | IPLVVPLRRRRRRRRC | RIPL | 16 | L | Linear | Chimeric | Cationic | Free | Free | RIPL peptides is conjugated to maleimide-derivatized liposomal vesicles via the thiol-maleimide reaction | Fluorophore (FITC) | 24704199 |
| 2216 | RRRRRRRRC | R8 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2217 | IPLVVPLC | IPL | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2218 | KFLNRFWHWLQLKPGQPMY | IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilytefluor 488 and TAMARA) | 24706763 |
| 2219 | KFLNRFWHWLQLKPGQPMY | TAMRA-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (TAMRA) | 24706763 |
| 2220 | KFLNRFWHWLQLKPGQPMY | Hilytefluor 488-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilyteflour) | 24706763 |
| 2221 | YGRKKRRQRRR | EGFP-TAT | 11 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2223 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | EGFP-VP_22 | 35 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2224 | LLIILRRRIRKQAHAHSK | EGFP-pVEC | 18 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2225 | GSVSRRRRRRGGRRRR | EGFP-LMWP | 16 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2226 | LGTYTQDFNKFHTFPQTAIGVGAP | EGFP-hcT(9-32) | 24 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2227 | KETWWETWWTEWSQPKKKRKV | EGFP-Pep-1 | 21 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2228 | GALFLGWLGAAGSTMGAPKKKRKV | EGFP-MPG | 24 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2229 | GLFRALLRLLRSLWRLLLRA | EGFP-ppTG20 | 20 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2230 | RRRRRRRRRRRR | EGFP-R12 | 12 | L | Linear | Synthetic | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2231 | KKALLALALHHLAHLALHLALALKKA | EGFP-LAH4 | 26 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2232 | YARVRRRGPRR | Hph-1 | 11 | L | Linear | Synthetic | Cationic | Conjugation with 6-histidine tag | Free | NA | Nucleic acid (Hph1Hph1dsRBD/FAM-labeled siRNA complex) | 24768403 |
| 2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2234 | CRQIKIWFQNRRMKWKKKLAKLAKKLAKLAK | KLA-Pen | 31 | L | Linear | Chimeric | Amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2235 | CRRLRHLRHHYRRRWHRFRC | Mgpe-9 | 20 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | Addition of cysteine in Mgpe3 sequence makes Mgpe9 | Nucleic acid (Plasmid DNA) | 24816284 |
| 2236 | CLLYWFRRRHRHHRRRHRRC | Mgpe-10 | 20 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | Addition of cysteine in Mgpe4 sequence makes Mgpe10 | Nucleic acid (Plasmid DNA) | 24816284 |
| 2237 | RRLRHLRHHYRRRWHRFR | Mgpe-3 | 18 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
| 2238 | LLYWFRRRHRHHRRRHRR | Mgpe-4 | 18 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
| 2239 | RKKNPNCRRH | hBCPP | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Smurf1-binding peptide) | 24831974 |
| 2242 | GRKKRRQRRRPPQY | Tat-Dex | 14 | L | Cyclic | Protein derived | Cationic | Free | Amidation | Dexamethasone | Dexamethasone | 24896852 |
| 2248 | RRRRRRRRR | R9-PCP | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2249 | RKKRRQRRR | Tat-PCP | 9 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2250 | RQIKIWFQNRRMKWKK | Antp-PCP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |