Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 83| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2013 | GALFLGFLGAAGSTMGAWSQPKSKRKV | MPGNLS | 27 | L | Linear | Synthetic | NA | Acetylation | Cysteamide group | NA | Nucleic acid (siRNA) | 23036951 |
| 2014 | GLWRALWRLLRSLWRLLWRA | CADY | 20 | L | Linear | Synthetic | Amphipathic | Acetylation | Cysteamide group | NA | Nucleic acid (siRNA) | 23036951 |
| 2131 | RRRRRRRR | R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Nucleic acid (GAPDH siRNA) | 25193363 |
| 2134 | RRRRRRRRRRRRRRR | R15 | 15 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Nucleic acid (GAPDH siRNA) | 25193363 |
| 2135 | HHHHHHHHRRRRRRRRRRRRRRR | H8R15 | 23 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Nucleic acid (GAPDH siRNA) | 25193363 |
| 2138 | HHHHHHHHHHHHHHHHRRRRRRRRRRRRRRR | H16R8 | 31 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Nucleic acid (GAPDH siRNA) | 25193363 |
| 2160 | RRRRRRRR | R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Nucleic acid (siRNA and miRNA) | 24969623 |
| 2193 | GRGDSPRR | Pep1 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2194 | GRGDSPRRSPRR | Pep2 | 12 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2195 | GRGDSPRRKKKKSPRRKKKKSPRR | Pep3 | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2196 | GRGDGPRRKKKKGPRRKKKKGPRR | Pep3(Mutant) | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid (Plasmid DNA) | 24462902 |
| 2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2234 | CRQIKIWFQNRRMKWKKKLAKLAKKLAKLAK | KLA-Pen | 31 | L | Linear | Chimeric | Amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2248 | RRRRRRRRR | R9-PCP | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2249 | RKKRRQRRR | Tat-PCP | 9 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2250 | RQIKIWFQNRRMKWKK | Antp-PCP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2260 | ISFDELLDYYGESGS | NYAD-41 | 15 | L | Linear | Synthetic | NA | Acetylation | Free | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2261 | ISF-R8-ELLDYY-S5-ESGS | NYAD-36 | 15 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2262 | ISF-R8-ELLDYY-S5-ED | NYAD-66 | 13 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2263 | ISF-R8-EWLQAY-S5-EDE | NYAD-67 | 14 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2292 | RRRRRRRR | F(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2293 | RRRRRRRR | G(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2294 | RQIKIWFQNRRMKWKK | F(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2295 | RQIKIWFQNRRMKWKK | G(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2296 | AGYLLGKINLKALAALAKKIL | F(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2297 | AGYLLGKINLKALAALAKKIL | G(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2315 | RXRRBRRXRYQFLIRXRBRXRB | Pip6a | 22 | Modified | Linear | Synthetic | NA | Acetylation | Free | B, Beta-Alanine and X, 6-aminohexanoic acid (Ahx) | Nucleic acid [phosphorodiamidate morpholino oligomers (PMO)] | 24366877 |
| 2325 | GALFLAFLAAALSLMGLWSQPKKKRKV | MPGα | 27 | L | Linear | Synthetic | Cationic | Acetylation | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2326 | GALFLGFLGAAGSTMGAWSQPKKKRKV | MPGβ | 27 | L | Linear | Synthetic | Cationic | Acetylation | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2407 | Ac-WELVVL-YGRKKRRQRRR | Ac-pep5-cpp | 17 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Peptide [Pep-5 (WELVVL)] | 24764300 |
| 2418 | GYGYGYGYGYGYGYGYKKRKKRKKRKKRKQQKQQKRRK | AcD4 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2422 | LALALALALALALALAKKLKKLKKLKKLKKLKKLKYAK | AcD6 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2424 | IKIKIKIKIKIKIKIKKLAKLAKLAKLAKLAKLAKKIK | AcD7 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2430 | LILILILILILILILIKRKKRKKRKKRKKRAKRAKHSK | AcD11 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2433 | LKKLLKLLKKLLKLAG | LK-1 | 16 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2434 | LKKLCKLLKKLCKLAG | LK-2 | 16 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2435 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2477 | CGRKKRRQRRRPPQ | NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2478 | KGRKKRRQRRRPPQ | d-NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2479 | KGRKKRRQRRRPPQ | q-NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2480 | CGRKKRRQRRRPPQ | n-NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2544 | YGRKKRRQRRR | Ac-TAT-substrate | 11 | L | Linear | Protein derived | NA | Acetylation | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2546 | KKWKMRRNQFWIKIQR | Ac-Penetratin-substrate | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2764 | RLLRLLLRLWRRLLRLLR | C6 | 18 | L | Linear | Synthetic | Amphipathic | Acetylation | Amidation | NA | Nucleic acid (siRNA) | 23077976 |
| 2826 | KLALKLALKALKAALKLA | MAP | 18 | L | Linear | Synthetic | Amphipathic | Acetylation | Amidation | NA | Nucleic acid [Oligonucleotides (ODNs)] | 24216093 |
| 2827 | KLULKLULKULKAULKLU | MAP(Aib) | 18 | Modified | Linear | Synthetic | Amphipathic | Acetylation | Amidation | U, α-amino isobutyric acid (Aib) | Nucleic acid [Oligonucleotides (ODNs)] | 24216093 |
| 2879 | Aib-NII-Aib-PLL-Aib-PIC | TV-XIIa | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
| 2880 | Aib-NII-Aib-PLL-A-PIC | P-I | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
| 2881 | A-NII-Aib-PLL-Aib-PIC | P-II | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
| 2882 | Aib-NII-A-PLL-Aib-PIC | P-III | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |