ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2998 | AGYLLGKINLKALAALAKKIL | Stearyl-TP10 | 21 | Modified | Linear | Protein derived | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (SCO) | 0 |
3007 | RQIKIWFQNRRMKWKK | Pen | 16 | L | Linear | Protein derived | Cationic and Amphipathic | NA | Amidation | NA | Nucleic acid (SCO) | 0 |
1001 | GRKKRRQRRRPPQ | Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Labelled with Cys-acetamidomethyl | Conjugation with fluorescein maleimide | NA | Fluorophore (fluorescein) | 9188504 |
1002 | LGISYGRKKRRQRRRPPQ | Tat (43-60) | 18 | L | Linear | Protein derived | Cationic | Labelled with Cys-acetamidomethyl | Conjugation with fluorescein maleimide | NA | Fluorophore (fluorescein) | 9188504 |
1003 | FITKALGISYGRKKRRQRRRPPQ | Tat (37-60) | 23 | L | Linear | Protein derived | Cationic | Labelled with Cys-acetamidomethyl | Conjugation with fluorescein maleimide | NA | Fluorophore (fluorescein) | 9188504 |
1004 | FITKALGISYGRKKRR | Tat (37-53) | 16 | L | Linear | Protein derived | Cationic | Labelled with Cys-acetamidomethyl | Conjugation with fluorescein maleimide | NA | Fluorophore (fluorescein) | 9188504 |
1005 | GRKKRRQRRR | Tat (48-57) | 10 | L | Linear | Protein derived | Cationic | Labelled with Cys-acetamidomethyl | Conjugation with fluorescein maleimide | NA | Fluorophore (fluorescein) | 0 |
1006 | RKKRRQRRR | Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1007 | RKKRRQRR | Tat (49-56) | 8 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1008 | RKKRRQR | Tat (49-55) | 7 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1009 | KKRRQRRR | Tat (50-57) | 8 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1010 | KRRQRRR | Tat (51-57) | 7 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1011 | rkkrrqrrr | D-Tat (49-57) | 9 | D | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1012 | RRRQRRKKR | Retro - Tat (57-49) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1013 | rrrqrrkkr | D-Tat (57-49) | 9 | D | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1014 | AKKRRQRRR | Ala49 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1015 | RAKRRQRRR | Ala50 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1016 | RKARRQRRR | Ala51 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1017 | RKKARQRRR | Ala52 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1018 | RKKRAQRRR | Ala53 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1019 | RKKRRARRR | Ala54 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1020 | RKKRRQARR | Ala55 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1021 | RKKRRQRAR | Ala56 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1022 | RKKRRQRRA | Ala57 substitution mutant of Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 11087855 |
1023 | GRKKRRQRRPPQC | Arg deletion mutant of Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1024 | GRKKRRQRPPQC | Arg deletion mutant of Tat (48-60) | 12 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1025 | GRKKRRQPPQC | Arg deletion mutant of Tat (48-60) | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1026 | GRKKRRQRRRC | Pro deletion mutant of Tat (48-60) | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1027 | GRKKRRQRARPPQC | Ala substitution mutant of Tat (48-60) | 14 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1028 | GRKKRRQARAPPQC | Ala substitution mutant of Tat (48-60) | 14 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1029 | TRQARRNRRRRWRERQR | Rev (34-50) | 17 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein by C-terminal Cys amide | NA | Fluorophore (fluorescein) | 11084031 |
1059 | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS | Galanin | 30 | L | Linear | Protein derived | Unknown | Biotinyl-Gly-Gly-N 25galanin(1-29) | Free | NA | Biotin | 10930519 |
1060 | INLKALAALAKKIL | MP | 14 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 10930519 |
1087 | RQIKIWFQNRRMKWKK | XV | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 10323198 |
1090 | RQIKIWFQNRRMKWKK | pAntpHD (43-58) | 16 | L | Linear | Protein derived | Amphipathic | Biotinylation | Amidation | NA | Biotin | 8663410 |
1091 | KKWKMRRNQFWIKIQR | pAntpHD (58-43) | 16 | L | Linear | Protein derived | Amphipathic | Biotinylation | Amidation | NA | Biotin | 8663410 |
1092 | rqikiwfqnrrmkwkk | D form of pAntpHD (43-58) | 16 | D | Linear | Protein derived | Amphipathic | Biotinylation | Amidation | NA | Biotin | 8663410 |
1093 | RQIKIWFPNRRMKWKK | pAntpHD (Pro50) | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Amidation | NA | Biotin | 8663410 |
1094 | RQPKIWFPNRRKPWKK | pAntpHD (3Pro) | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Amidation | NA | Biotin | 8663410 |
1095 | RQIKIWFQNRRMKWKK | pAntp (43-58) | 16 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1096 | RQIKIWFQNRRMKWK | pAntp (43-57) | 15 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1097 | RQIKIWFQNRRMKW | pAntp (43-56) | 14 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1098 | RQIKIWFQNRRMK | pAntp (43-55) | 13 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1099 | RQIKIWFQNRRM | pAntp (43-54) | 12 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1100 | RQIKIWFQNRR | pAntp (43-53) | 11 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1101 | RQIKIWFQNR | pAntp (43-52) | 10 | L | Linear | Protein derived | Unknown | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1102 | RQIKIWFQN | pAntp (43-51) | 9 | L | Linear | Protein derived | Unknown | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1103 | RQIKIWFQ | pAntp (43-50) | 8 | L | Linear | Protein derived | Unknown | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1104 | RQIKIW | pAntp (43-48) | 6 | L | Linear | Protein derived | Unknown | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |
1105 | QIKIWFQNRRMKWKK | pAntp (44-58) | 15 | L | Linear | Protein derived | Probably Amphipathic | Biotinylation (Labeled with Biotinyl-beta-Alanine) | Amidation | NA | Biotin | 10784032 |