|
AVPdb
A Database of Antiviral Peptides
|
|
AVP0128 details | |
AVPid | AVP0128 |
Sequence | INFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS |
Nomenclature | T-105 |
Length | 35 |
Against virus | Respiratory syncytial virus (RSV) |
Virus Family | Paramyxoviridae |
Source | RSV fusion (F) protein |
Uniprot | P03420 |
Cell line | HEp2 |
Inhibition/IC50 | 93 |
Unit |
EC50 (μM) |
Target | Fusion |
Assay | Cytopathic effect |
Properties | View |
Structure | Jmol |
Paper | Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. |
Authors | Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr. |
Reference | Proc Natl Acad Sci U S A. 1996 |
Accession | 8700906 |