| AVPid | AVP0541 |
| Sequence | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
| Nomenclature | DN59 |
| Length | 33 |
| Against virus | West nile virus (WNV) |
| Virus Family | Flaviviridae |
| Source | Synthetic |
| Cell line | LLC-MK2 |
| Inhibition/IC50 | 93±2 |
| Unit | % |
| Target | Virus entry |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Peptide inhibitors of dengue virus and West Nile virus infectivity. |
| Authors | Hrobowski YM, Garry RF, Michael SF. |
| Reference | Virol J. 2005 |
| Accession | 15927084 |
 |
 |