AVPid | AVP0541 |
Sequence | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
Nomenclature | DN59 |
Length | 33 |
Against virus | West nile virus (WNV) |
Virus Family | Flaviviridae |
Source | Synthetic |
Cell line | LLC-MK2 |
Inhibition/IC50 | 93±2 |
Unit | % |
Target | Virus entry |
Assay | Plaque assay |
Properties | View |
Structure | Jmol |
Paper | Peptide inhibitors of dengue virus and West Nile virus infectivity. |
Authors | Hrobowski YM, Garry RF, Michael SF. |
Reference | Virol J. 2005 |
Accession | 15927084 |
![]() |
![]() |