 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1721 details | |
|---|
| AVPid | AVP1721 |
| Sequence | YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV |
| Nomenclature | His6-HR1 |
| Length | 60 |
| Against virus | SARS coronavirus (SARS-CoV) |
| Virus Family | Coronaviridae |
| Source | SARS-CoV spike protein |
| Uniprot | P59594 |
| Cell line | Vero E3 |
| Inhibition/IC50 | ND |
| Unit |
μM(EC50) |
| Target | Virus entry |
| Assay | Luciferase assay |
| Properties | View |
| Structure | Jmol |
| Paper | Fusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors. |
| Authors | Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM. |
| Reference | J Cell Biochem. 2008 |
| Accession | 18442051 |