 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1750 details | |
|---|
| AVPid | AVP1750 |
| Sequence | MRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
| Nomenclature | AvBD6 |
| Length | 67 |
| Against virus | Duck hepaptitis virus (DHV) |
| Virus Family | Picornaviridae |
| Source | Duck beta defensin |
| Uniprot | Q6QLR3 |
| Cell line | Duck embryo |
| Inhibition/IC50 | High |
| Unit |
- |
| Target | Replication |
| Assay | Neutralization assay |
| Properties | View |
| Structure | Jmol |
| Paper | Identification, expression and activity analyses of five novel duck beta-defensins. |
| Authors | Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S. |
| Reference | PLoS One. 2012 |
| Accession | 23112840 |