AVPdb | A database of experimentally verified antiviral peptides

AVPdb A Database of Antiviral Peptides

AVP2000 details



AVPid	AVP2000
Sequence	KQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK
Nomenclature	G149-197
Length	49
Against virus	Respiratory syncytial virus (RSV)
Virus Family	Paramyxoviridae
Source	RSV attachment glycoprotein
Uniprot	P03423
Cell line	HEp-2
Inhibition/IC₅₀	80
Unit	μM
Target	Cytopathic effect
Assay	NMR
Properties	View
Structure	Jmol
Paper	Antiviral activity and structural characteristics of the nonglycosylated central subdomain of human respiratory syncytial virus attachment (G) glycoprotein.
Authors	Gorman JJ, McKimm-Breschkin JL, Norton RS, Barnham KJ.
Reference	J Biol Chem. 2001
Accession	11487583