Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 1564| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2594 | RRRRRRRR-RGD | R8-RGD | 11 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposome) | 24651033 |
| 2595 | KIAKLKAKIQKLKQKIAKLK | fGeT | 20 | L | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (Carboxyflouresein) | 24657280 |
| 2596 | YGRKKRRQRRR | fTat | 11 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (Carboxyflouresein) | 24657280 |
| 2597 | CCTGRKKRRQRRR | TAT | 13 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle | 24736021 |
| 2598 | IPLVVPLRRRRRRRRC | RIPL peptide | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Liposomes), Fluorophore (FITC) | 24704199 |
| 2599 | GGAYVTRSSAVRLRSSVPGVRLLQ | CF-Vim-TBS.58-81 | 24 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Carboxyfluorescein) | 21575694 |
| 2600 | GRKKRRQRRRPPQ | CF-Tat.48-60 | 13 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Carboxyfluorescein) | 21575694 |
| 2601 | GLRKRLRKFRNKIKEK | CF-sC18 | 16 | L | Linear | Synthetic | NA | Amidation | NA | NA | Fluorophore (Carboxyfluorescein) | 21956822 |
| 2610 | RKKRRQRRR | TAT | 9 | L | Linear | Protein derived | Cationic | NA | NA | NA | Nucleic acid (Calcium comlexed siRNA) | 21856394 |
| 2611 | RKKRRQRRRHRRKKR | dTAT | 15 | L | Linear | Synthetic | Cationic | NA | NA | NA | Nucleic acid (Calcium comlexed siRNA) | 21856394 |
| 2612 | VSRRRRRRGGRRRR | LMWP-TAZ | 14 | L | Linear | Synthetic | Cationic | NA | NA | NA | Protein [TAZ (transcriptional co-activator with PDZ-binding motif)] | 21990606 |
| 2613 | LLIILRRRIRKQAHAHSK | pVEC | 18 | L | Linear | Protein derived | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
| 2614 | LLIILRRRIRRRARARSR | P9R | 18 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
| 2615 | LLHILRRSIRKQAHAIRK | S6KR | 18 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
| 2616 | LLRILRRSIRRARRAIRR | S9R | 18 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
| 2617 | LLHILRRSIRRQAHAIRR | S6R | 18 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
| 2618 | LLRHLRRHIRRARRHIRR | S9RH | 18 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
| 2619 | MAMPGEPRRANVMAHKLEPASLQLR NSCA | CPPK | 29 | L | Linear | Synthetic | NA | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 22076844 |
| 2620 | MAPQRDTVGGRTTPPSWGPAKAQLRNSCA | CPPL | 29 | L | Linear | Synthetic | NA | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 22076844 |
| 2621 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | Cationic | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 22076844 |
| 2622 | CGRKKRRQRRRPPQ | Tat | 14 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2623 | CGRKKRWWRQRRRPPQ | II | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2624 | CGRKKRRQRRWWRPPQ | III | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2625 | CGRKKRRQRWWRRPPQ | IV | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2626 | CGRKKRWWRQRWWRWWRPPQ | V | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2627 | CGRKKRAARQRRRPPQ | VI | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2628 | CGRKKRRQRRAARPPQ | VII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2629 | CGRKKRRQRAARRPPQ | VIII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2630 | CGRKKRAARQRAARAARPPQ | IX | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2631 | CGRKKRLLRQRRRPPQ | X | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2632 | CGRKKRRQRRLLRPPQ | XI | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2633 | CGRKKRRQRLLRRPPQ | XII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2634 | CGRKKRLLRQRLLRLLRPPQ | XIII | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2635 | CGRKKRRQRR-Ahx-RPPQ | XIV | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2636 | CGRKKR-Ahx-RQRRRPPQ | XV | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2637 | CGRKKRRQR-Ahx-RRPPQ | XVI | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2638 | CGRKKR-Ahx-RQR-Ahx-R-ahx-RPPQ | XVII | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2639 | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG | Crotamine | 42 | L | Linear | Protein derived | NA | NA | NA | NA | Fluorophore (Alexa 700) | 22142367 |
| 2640 | INLKALAALAKKIL | TAM-MP | 14 | L | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | NA | Fluorophore (TAMRA) | 22148546 |
| 2642 | LIKKALAALAKLNI | TAM-rMP | 14 | L | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | NA | Fluorophore (TAMRA) | 22148546 |
| 2648 | CAYGRKKRRQRRR | TAT | 13 | L | Linear | Protein derived | Cationic | Cysteine addition | NA | NA | Nanoparticle (Liposomes) | 22188312 |
| 2649 | CRKARYRGRKRQR | D-TAT | 13 | L | Linear | Synthetic | Cationic | Cysteine addition | NA | NA | Nanoparticle (Liposomes) | 22188312 |
| 2650 | CAYGGQQGGQGGG | S-TAT | 13 | L | Linear | Synthetic | Cationic | Cysteine addition | NA | NA | Nanoparticle (Liposomes) | 22188312 |
| 2651 | CRRRRRRRR | R8 | 9 | L | Linear | Synthetic | Cationic | Cysteine addition | NA | NA | Nanoparticle (Liposomes) | 22188312 |
| 2652 | KLALKLALKALKAALKLA | Cyt c-ss-MAP | 18 | L | Linear | Synthetic | Amphipathic | Conjugated to Radiolabeled cytochrome c with disulphide linkage | NA | NA | Protein (Cyt C protein) | 22225540 |
| 2653 | RRRRRRRR | Cyt c-ss-R8 | 8 | L | Linear | Synthetic | Cationic | Conjugated to Radiolabeled cytochrome c with disulphide linkage | NA | NA | Protein (Cyt C protein) | 22225540 |
| 2658 | RRRRRRRR | M Peptide 8F-L | 8 | L | Linear | Synthetic | Cationic | Conjugation with HIV inhibiting peptide | Amidation | GABA spacer | Peptide (HIV inhibiting peptide) | 22277590 |
| 2659 | RRRRRRRR | M Peptide 14F-L | 8 | L | Linear | Synthetic | Cationic | Conjugation with HIV inhibiting peptide | Amidation | GABA spacer | Peptide (HIV inhibiting peptide) | 22277590 |
| 2660 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 22281502 |
| 2661 | RQIKIWFQNRRMKWKKC | Pen-Cys | 17 | L | Linear | Protein derived | Cationic and amphipathic | NA | NA | Cysteine modification | Nucleic acid (Plasmid DNA) | 22281502 |