Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 391| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2010 | YGRKKRRQRRR | Tat-AIE dots | 11 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | TPETPAFN and TPAFN | 23359649 |
| 2011 | KKALLAHALHLLALLALHLAHALKKA | LAH4-L1 | 26 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (siRNA) | 23436406 |
| 2014 | GLWRALWRLLRSLWRLLWRA | CADY | 20 | L | Linear | Synthetic | Amphipathic | Acetylation | Cysteamide group | NA | Nucleic acid (siRNA) | 23036951 |
| 2032 | GRKKRRQRRRP | TAT(47-57) | 11 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2033 | KLAKLAKKLAKLAK | KLA | 14 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2036 | AGYLLGOINLKALAALAKKIL | NF51 | 21 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | O, Ornithine | Nucleic acid (Plasmid DNA, SCO and siRNA) | 23357356 |
| 2037 | AGYLLGKINLKALAALAKKIL | NF53 | 21 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | ε-NH2 group of Lys7 for subsequent synthesis | Nucleic acid (Plasmid DNA, SCO and siRNA) | 23357356 |
| 2038 | AGYLLGKINLKALAALAKKIL | NF61 | 21 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | α-NH2 group of Lys7 for subsequent synthesis | Nucleic acid (Plasmid DNA, SCO and siRNA) | 23357356 |
| 2045 | RPARPAR | PA 1 | 7 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Fluorophore (Rhodamine) | 23349939 |
| 2046 | RPARPAR | PA 2 | 7 | L | Linear | Synthetic | Amphipathic | Di-palmitilysation | Free | NA | Fluorophore (Rhodamine) | 23349939 |
| 2047 | RPARPAR | PA 3 | 7 | L | Linear | Synthetic | Amphipathic | Di-palmitilysation | Amidation | NA | Fluorophore (Rhodamine) | 23349939 |
| 2048 | RPARPAR | PA 4 | 7 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | DSP-PEG2000 and Fluorophore (Rhodamine) | 23349939 |
| 2049 | RPARPAR | PA 5 | 7 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | DSP-PEG2000 and Fluorophore (Rhodamine) | 23349939 |
| 2050 | RPARPAR | PA 8 | 7 | L | Linear | Synthetic | Amphipathic | Di-palmitilysation | Free | NA | Fluorophore (Oregon514 dye) | 23349939 |
| 2057 | RGD-ADDA-RRRRRRRR | P1 | 11 | Modified | Linear | Synthetic | Amphipathic | NA | Free | 12-aminododecanoic acid (ADDA) linked RGD motif to P1 | Nucleic acid (Plasmid DNA) | 23281275 |
| 2058 | RGD-Ahx-RRRRRRRR | P2 | 11 | Modified | Linear | Synthetic | Amphipathic | NA | Free | RGD motif is linked by P2 through 6-aminohexanoic acid (Ahx). | Nucleic acid (Plasmid DNA) | 23281275 |
| 2059 | RGD-RRRRRRRR | P3 | 11 | Modified | Linear | Synthetic | Amphipathic | NA | Free | RGD motif is linked to P3 | Nucleic acid (Plasmid DNA) | 23281275 |
| 2060 | RRRRRRRR | P4 | 8 | L | Linear | Synthetic | Amphipathic | NA | Free | NA | Nucleic acid (Plasmid DNA) | 23281275 |
| 2096 | RQIKIWFQNRRMKWKK | Pen-GFP | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2097 | RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWK | Pen-GFP-Pen | 31 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2126 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (Insulin) | 24060698 |
| 2148 | CIGAVLKVLTTGLPALISWIKRKRQQ | Melittin | 26 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2149 | AGYLLGKINLKALAALAKKILGGC | Transportan 10 | 24 | L | Linear | Chimeric | Amphipathic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2150 | GKKALKLAAKLLKKC | GKK peptide | 15 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2155 | LIRLWSHLIHIWFQNRRLKWKKKGGC | EB-1 | 26 | L | Linear | Synthetic | Amphipathic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2156 | WEAKLAKALAKALAKHLAKALAKALKACEA | KALA | 30 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2161 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2162 | rqikiwfqnrrmkwkk | Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2163 | WEARLARALARALARHLARALARA | RALA peptide | 24 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (pDNA) | 24995949 |
| 2171 | GWTLNSAGYLLGKINLKALAALAKKIL | Transportan | 27 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2172 | KLALKLALKALKAALKLA | MAP | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2174 | RQIKIWFQNRRMKWKK | pAntp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2177 | AGYLLGKINLKALAALAKKIL | TP10 | 21 | L | Linear | Protein derived | Amphipathic | Conjugation with Oregon Green 488 | Amidation | NA | Fluorophore (Oregon Green 488) | 25016968 |
| 2197 | LLKLLKKLLKLLKKLLKLL | PF20 | 19 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2198 | WLKLLKKWLKLWKKLLKLW | PF21 | 19 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2199 | FLKLLKKFLKLFKKLLKLF | PF22 | 19 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2200 | WLOLLOOWLOLWOOLLOLW | PF23 | 19 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | O, Ornithine | Nucleic acid (Plasmid DNA) | 24463071 |
| 2201 | WLOLLROWLRLWORLLOLW | PF24 | 19 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | O, Ornithine | Nucleic acid (Plasmid DNA) | 24463071 |
| 2202 | WLRLLORWLOLWROLLRLW | PF25 | 19 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | O, Ornithine | Nucleic acid (Plasmid DNA) | 24463071 |
| 2203 | WLKY(PO3)LLKKWLKLWKKLLKLW | PF26 | 20 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2204 | Y(PO3)WLKLLKKWLKLWKKLLKLW | PF27 | 20 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2205 | WLKLWKKWLKLW | PF28 | 12 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2206 | KALKLKLALALLAKLKLA | NAP | 18 | L | Linear | Synthetic | Non-Amphipathic | Free | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2207 | KALKLKLALALLAKLKLA | Stearyl-NAP | 18 | L | Linear | Synthetic | Non-Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2209 | RWRRWWRRW | RW9 | 9 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2210 | RRWRRWWRRWWRRWRR | RW16 | 16 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2211 | BRRXRRXRRX | FAM-1 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2212 | BrrXrrXrrX | ent FAM-1 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2213 | BRrXRrXRrX | FAM-2 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2214 | BXRXRXXRXRXXRXRX | FAM-3 | 16 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |