ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2195 | GRGDSPRRKKKKSPRRKKKKSPRR | Pep3 | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
2196 | GRGDGPRRKKKKGPRRKKKKGPRR | Pep3(Mutant) | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid (Plasmid DNA) | 24462902 |
2208 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
2209 | RWRRWWRRW | RW9 | 9 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
2210 | RRWRRWWRRWWRRWRR | RW16 | 16 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
2215 | IPLVVPLRRRRRRRRC | RIPL | 16 | L | Linear | Chimeric | Cationic | Free | Free | RIPL peptides is conjugated to maleimide-derivatized liposomal vesicles via the thiol-maleimide reaction | Fluorophore (FITC) | 24704199 |
2216 | RRRRRRRRC | R8 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 24704199 |
2217 | IPLVVPLC | IPL | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 24704199 |
2218 | KFLNRFWHWLQLKPGQPMY | IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilytefluor 488 and TAMARA) | 24706763 |
2219 | KFLNRFWHWLQLKPGQPMY | TAMRA-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (TAMRA) | 24706763 |
2220 | KFLNRFWHWLQLKPGQPMY | Hilytefluor 488-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilyteflour) | 24706763 |
2221 | YGRKKRRQRRR | EGFP-TAT | 11 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2223 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | EGFP-VP_22 | 35 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2224 | LLIILRRRIRKQAHAHSK | EGFP-pVEC | 18 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2225 | GSVSRRRRRRGGRRRR | EGFP-LMWP | 16 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2226 | LGTYTQDFNKFHTFPQTAIGVGAP | EGFP-hcT(9-32) | 24 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2227 | KETWWETWWTEWSQPKKKRKV | EGFP-Pep-1 | 21 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2228 | GALFLGWLGAAGSTMGAPKKKRKV | EGFP-MPG | 24 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2229 | GLFRALLRLLRSLWRLLLRA | EGFP-ppTG20 | 20 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2230 | RRRRRRRRRRRR | EGFP-R12 | 12 | L | Linear | Synthetic | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2231 | KKALLALALHHLAHLALHLALALKKA | EGFP-LAH4 | 26 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2232 | YARVRRRGPRR | Hph-1 | 11 | L | Linear | Synthetic | Cationic | Conjugation with 6-histidine tag | Free | NA | Nucleic acid (Hph1Hph1dsRBD/FAM-labeled siRNA complex) | 24768403 |
2235 | CRRLRHLRHHYRRRWHRFRC | Mgpe-9 | 20 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | Addition of cysteine in Mgpe3 sequence makes Mgpe9 | Nucleic acid (Plasmid DNA) | 24816284 |
2236 | CLLYWFRRRHRHHRRRHRRC | Mgpe-10 | 20 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | Addition of cysteine in Mgpe4 sequence makes Mgpe10 | Nucleic acid (Plasmid DNA) | 24816284 |
2237 | RRLRHLRHHYRRRWHRFR | Mgpe-3 | 18 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
2238 | LLYWFRRRHRHHRRRHRR | Mgpe-4 | 18 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
2239 | RKKNPNCRRH | hBCPP | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Smurf1-binding peptide) | 24831974 |
2257 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP43 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
2258 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP63 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
2259 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP122 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
2260 | ISFDELLDYYGESGS | NYAD-41 | 15 | L | Linear | Synthetic | NA | Acetylation | Free | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
2264 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1LXXLL | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
2265 | PKKKRKV-RRRRRRR-YSQTSHKLVQLLTTAEQQ | R7-SRC1LXXLL | 32 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
2266 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1(1222-1245) | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
2267 | PKKKRKV-RRRRRRR-PQMQQNVFQYPGAGMVPQGEANF | R7-SRC1(1222-1245) | 37 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
2268 | LCLRPVG | Xentry peptides | 7 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2269 | LCLRP | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2270 | LCLR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2271 | LLR | Xentry peptides | 3 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2272 | LLLR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2273 | LLLLR | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2274 | LLLRR | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2275 | IIIR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2276 | VVVR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2277 | LCLK | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2278 | LCLH | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2279 | LCLE | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2280 | LCLN | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2281 | LCLQ | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |