Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 741| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2399 | WELVVL-YGRKKRRQRRR | C3-pep5-cpp* | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVVL)] | 24764300 |
| 2400 | WELVV-YGRKKRRQRRR | C4-pep5-cpp | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVV)] | 24764300 |
| 2401 | WELV-YGRKKRRQRRR | C5-pep5-cpp | 15 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELV)] | 24764300 |
| 2402 | WEL-YGRKKRRQRRR | C6-pep5-cpp | 14 | L | Linear | Synthetic | Cationic | Free | Free | NA | peptide [Pep-5 (WEL)] | 24764300 |
| 2403 | WE-YGRKKRRQRRR | C7-pep5-cpp | 13 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WE)] | 24764300 |
| 2404 | WELVVA-YGRKKRRQRRR | A | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVVA)] | 24764300 |
| 2405 | WEAVVL-YGRKKRRQRRR | B | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WEAVVL)] | 24764300 |
| 2406 | WEAVVA-YGRKKRRQRRR | C | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WEAVVA)] | 24764300 |
| 2407 | Ac-WELVVL-YGRKKRRQRRR | Ac-pep5-cpp | 17 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Peptide [Pep-5 (WELVVL)] | 24764300 |
| 2431 | RKKRRQRRR | FabRev1-Tat | 9 | L | Linear | Synthetic | Cationic | Fused with protein C-terminus | Free | NA | Protein (Rev) | 24878961 |
| 2432 | GRKKRRQRRRCG | Tat-CG | 12 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid [FAM-siRNA (1 g) in combination with MPEG-PCL] | 24708261 |
| 2436 | VTPHHVLVDEYTGEWVDSQFK | VG-21 | 21 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25154664 |
| 2441 | YGRKKRRQRRR | PNIPAM-FL-TAT Peptide | 11 | L | Linear | Protein derived | Cationic | Conjugated with PNIPAM-FL molecule | Free | NA | Nanoparticle [poly(N-isopropylacrylamide) (PNIPAM) microgel particles] | 25170605 |
| 2445 | mPEG-PLA-HEHEHEHEHE | HEI | 10 | L | Linear | Synthetic | Cationic | Conjugated with PEG-PLA | Free | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2446 | mPEG-PLA-RGRGRGRGRG | RGI | 10 | L | Linear | Synthetic | Cationic | Conjugated with PEG-PLA | Free | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2447 | RRIRPRPPRLPRPRPRPLPFPRPG | p21-ELP1-Bac | 24 | L | Linear | Synthetic | NA | Conjugated with p21-ELP1 | Free | NA | Peptide (p21-ELP) | 24680816 |
| 2450 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2451 | rqikiwfqnrrmkwkk | Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2452 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-II | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2453 | GGVCPKILKKCRRDSDCPGACICRGNGWCGSGSD | MCoTI-M1 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2454 | GGVCPKILRRCRRDSDCPGACICRGNGYCGSGSD | MCoTI-M2 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2455 | GGVCPKILRRCRRDSDCPGACICRGNGWCGSGSD | MCoTI-M3 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2456 | GGVCPKILRRCRRDSDCPGACICRGNGYCGSGSR | MCoTI-M4 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2457 | GGVCPRILRRCRRDSDCPGACICRGNGYCGSGSK | MCoTI-M5 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2458 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-M6 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2459 | GRCTKSIPPICFPD | SFTI-1 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2460 | grctksippicfpd | D-SFTI-1 | 14 | D | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2461 | GACTKSIPPICFPD | SFTI-M1 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2462 | GRCTKSIPPICFPA | SFTI-M2 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2463 | GRCTKSIPPICWPD | SFTI-M3 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2464 | GRCTKSIPPICWPK | SFTI-M4 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2465 | GRCTRSIPPKCWPD | SFTI-M5 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2466 | GRXTKSIPPIXFPD | SFTI-M6 | 14 | Modified | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | X, α-aminobutyric acid | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2467 | GRXTKSIPPIXFPD | SFTI-M7 | 14 | Modified | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | X, α-aminobutyric acid | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2468 | YGRKKRRQRRRPPQG | TAT | 15 | L | Linear | Protein derived | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2469 | WEARLARALARALARHLARALARALRACEA | RALA | 30 | L | Linear | Synthetic | Cationic and amphipathic | Free | Free | NA | Nanoparticle (Cy3-labeled nanoparticles complexed with DNA) | 24995949 |
| 2470 | VSRRRRRRGGRRRR | C24-LMWP | 14 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (LMWP/PLGA nanoparticles), Small molecule drug (Doxorubicin) | 25003794 |
| 2471 | HSDAVFTDNYTALRKQMAVKKYLNSILNYGRKKRRQRRR | VIP-TAT | 39 | L | Linear | Protein derived | Cationic | Conjugated with VIP | Free | NA | Fluorophore (FITC) | 25086267 |
| 2491 | CGYGRKKRRQRRRGC | Tat | 15 | L | Linear | Protein derived | Cationic | Free | Free | NA | Ultrasound contrast agent (UCA), Fluorophore (FITC) | 24985759 |
| 2504 | YGRKKRRQRRR | TAT-lyophiliosomes | 11 | L | Linear | Protein derived | Cationic | Conjugated with lyophilisome via cysteine linker | Free | NA | Nanoparticle (Lyophiliosomes and FITC labelled) | 25369131 |
| 2507 | MGVADLIKKFESISKEEGGGGK(Ahx-FITC)-GGrRrRrRRR | probe1 | 32 | Mix | Linear | Synthetic | NA | Conjugated to recognition unit via Ahx-FITC-GG | Free | NA | Fluorophore (FITC) | 25410769 |
| 2508 | MGVADLIKKFESISKEEGGGGK(RhB)GGrRrRrRRR | probe2 | 32 | Mix | Linear | Synthetic | NA | Conjugated to recognition unit via Rhb-GG | Free | NA | Fluorophore (rhodamine B) | 25410769 |
| 2509 | MGVADLIKKFESISKEEGGGGK(PA-RhB)GGrRrRrRRR | probe3 | 32 | Mix | Linear | Synthetic | NA | Conjugated to recognition unit via PA-Rhb-GG | Free | NA | Fluorophore (photo-activatable rhodamine B) | 25410769 |
| 2516 | ESGGGGSPGRRRRRRRRRRR | c-Myc-R11 | 20 | L | Linear | Synthetic | Cationic | Conjugated with c-Myc protein | Free | NA | Protein (c-myc) | 25473453 |
| 2525 | KWCFRVCYRGICYRRCRGK | Tpl | 19 | L | Linear | Protein derived | NA | Biotinylation | Free | NA | Protein (?-glucuronidase enzyme, ?-galactosidase) | 25514997 |
| 2526 | KWSFRVSYRGISYRRSRGK | MTpl-1 | 19 | L | Linear | Synthetic | NA | Biotinylation | Free | NA | Protein (?-glucuronidase enzyme, ?-galactosidase) | 25514997 |
| 2527 | KWFRVYRGIYRRRGK | MTpl-2 | 15 | L | Linear | Synthetic | NA | Biotinylation | Free | NA | Protein (?-glucuronidase enzyme, ?-galactosidase) | 25514997 |
| 2528 | KWCFAVCYAGICYAACAGK | MTpl-3 | 19 | L | Linear | Synthetic | NA | Biotinylation | Free | NA | Protein (?-glucuronidase enzyme, ?-galactosidase) | 25514997 |
| 2539 | HHHRRRRRRRR | 5-FAM-H3R8 | 11 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (5-FAM) | 25547808 |
| 2540 | HHHRRRRRRRR | MTS-(5-FAM)- H3R8 | 11 | L | Linear | Synthetic | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (5-FAM) and MTS | 25547808 |