| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2012 | RRRRRRRR | R9-GFP | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Protein (eGFP) | 23497160 |
| 2016 | GSRVQIRCRFRNSTR | HSV-1 glycoprotein C gene (gC)--Crystallins | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Protein (Human B-Crystallin) | 23150610 |
| 2017 | GRKKRRQRRRPQ | HIV-1 TAT peptide--Crystallins | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (Human B-Crystallin) | 23150610 |
| 2022 | NYRWRCKNQN | ECP(32-41) | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC), Protein (eGFP) and Peptide (KLA) | 23469189 |
| 2071 | HHHHHHESGGGGSPGRRRRRRRRRRR | Foxp3-11R | 26 | L | Linear | Synthetic | NA | Conjugation with 6-histidine tag | NA | Linker (ESGGGGSPG) | Fluorophore (FITC) and protein (monoclonal antibodies) | 23541572 |
| 2090 | YGRKKRRQRRR | 6His-TAT-GFP | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (eGFP) | 23454269 |
| 2091 | YGRKKRRQRRR | 6xHis-TAT-SOD | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (Cu,Zn-superoxide dismutase) | 23289802 |
| 2092 | YTFGLKTSFNVQ | Ypep-GFP | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2093 | YTFGLKTSFNVQYTFGLKTSFNVQ | Ypep-GFP-Ypep | 24 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2094 | YGRKKRRQRRR | Tat-GFP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2095 | YGRKKRRQRRRYGRKKRRQRRR | Tat-GFP-Tat | 22 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2096 | RQIKIWFQNRRMKWKK | Pen-GFP | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2097 | RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWK | Pen-GFP-Pen | 31 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2101 | RRRRRRRR | GC/R8-Lip | 8 | L | Linear | Synthetic | NA | Stearylation | Free | NA | Protein [GC (-galactosylceramide), ovalbumin] | 23860186 |
| 2126 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (Insulin) | 24060698 |
| 2127 | KWFKIQMQIRRWKNKR | PenetraMax | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Protein (Insulin) | 24060698 |
| 2129 | YGRKKRRQRRR | TAT-gelonin | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (gelonin) | 25204286 |
| 2130 | RRRRRRRRRRR | poly-arginine | 11 | L | Linear | Synthetic | Cationic | Free | Conjugation with 6His-tag | NA | Protein (Oct-4 protein) | 25199543 |
| 2161 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2162 | rqikiwfqnrrmkwkk | Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2221 | YGRKKRRQRRR | EGFP-TAT | 11 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2223 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | EGFP-VP_22 | 35 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2224 | LLIILRRRIRKQAHAHSK | EGFP-pVEC | 18 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2225 | GSVSRRRRRRGGRRRR | EGFP-LMWP | 16 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2226 | LGTYTQDFNKFHTFPQTAIGVGAP | EGFP-hcT(9-32) | 24 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2227 | KETWWETWWTEWSQPKKKRKV | EGFP-Pep-1 | 21 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2228 | GALFLGWLGAAGSTMGAPKKKRKV | EGFP-MPG | 24 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2229 | GLFRALLRLLRSLWRLLLRA | EGFP-ppTG20 | 20 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2230 | RRRRRRRRRRRR | EGFP-R12 | 12 | L | Linear | Synthetic | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2231 | KKALLALALHHLAHLALHLALALKKA | EGFP-LAH4 | 26 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2240 | Cyclo (FΦRRRRQ) | cFΦR4-Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Fluorophore (Rhodamine), Protein (GFP) | 24896852 |
| 2292 | RRRRRRRR | F(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2293 | RRRRRRRR | G(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2294 | RQIKIWFQNRRMKWKK | F(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2295 | RQIKIWFQNRRMKWKK | G(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2296 | AGYLLGKINLKALAALAKKIL | F(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2297 | AGYLLGKINLKALAALAKKIL | G(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2298 | RGDfK | cRGD | 5 | L | Cyclic | Protein derived | NA | Cycliclization | Cyclization | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2306 | VSRRRRRRGGRRRR | LMWP | 14 | L | Linear | Synthetic | NA | Free | Free | NA | Protein [PDZ-binding motif (TAZ)] | 24648725 |
| 2307 | RRRRRRR | R7 | 7 | L | Linear | Synthetic | Cationic | Free | Free | NA | Protein (ESRRB recombinant protein) | 24693491 |
| 2308 | GGGGRRRRRRRRRLLLL | m9R | 17 | L | Linear | Synthetic | Cationic | Maleimide addition | Free | NA | Protein (Cas9) | 24696462 |
| 2323 | RQIKIWFQNRRMKWKK | Penetratin (Antennapedia) | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2324 | YGRKKRRQRRR | HIV-TAT (47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2325 | GALFLAFLAAALSLMGLWSQPKKKRKV | MPGα | 27 | L | Linear | Synthetic | Cationic | Acetylation | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2326 | GALFLGFLGAAGSTMGAWSQPKKKRKV | MPGβ | 27 | L | Linear | Synthetic | Cationic | Acetylation | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2327 | GLWRALWRLLRSLWRLLWKA | CAD-2 (des-acetyl, Lys19-CADY) | 20 | L | Linear | Synthetic | Cationic | Free | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2328 | KLPVM | CPPP-2 | 5 | L | Linear | Synthetic | Cationic | Free | Free | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2335 | CELAGIGILTVRKKRRQRRR | Alexa488-Melan-A-TAT | 20 | L | Linear | Chimeric | Cationic | Conjugation with Alexa488 C5 maleimide | Free | NA | Fluorophore (Alexa488) and Protein (ovalbumin) | 24372650 |
| 2336 | CELAGIGILTVKKKKKQKKK | Alexa488-Melan-A-polyLys (control peptide) | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Alexa488) and Protein (ovalbumin) | 24372650 |