Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 1564| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2055 | GRRRRRRRRR | R9 | 10 | L | Linear | Synthetic | Cationic | Conjugation with carboxytetramethyl rhodamine B | Amidation | NA | Fluorophore (TMR, Alexa fluors and Cy3) | 23278754 |
| 2056 | KKKKKKKKK | K9 | 9 | L | Linear | Synthetic | Cationic | Conjugation with carboxytetramethyl rhodamine B | Amidation | NA | Fluorophore (TMR, Alexa fluors and Cy3) | 23278754 |
| 2060 | RRRRRRRR | P4 | 8 | L | Linear | Synthetic | Amphipathic | NA | Free | NA | Nucleic acid (Plasmid DNA) | 23281275 |
| 2061 | GGRRARRRRRR | CTP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Peptide (HBcAg18 27-Tapasin) | 23299079 |
| 2062 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | NA | Free | Free | Histidine tagged | Nanoparticles [Nanostructured lipid carriers (NLC) and Ibuprofen (Ibu)] | 23187866 |
| 2063 | YKALRISRKLAK | YKA peptide | 12 | L | Linear | Synthetic | NA | Free | Free | Histidine tagged | Nanoparticles [Nanostructured lipid carriers (NLC) and Ibuprofen (Ibu)] | 23187866 |
| 2064 | KETWWETWWTEWSQPKKKRKVC | FP-lipo | 22 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes and folic acid) | 23515421 |
| 2065 | RRRRR | R5 | 5 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 23534410 |
| 2066 | RRRRRRR | R7 | 7 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 23534410 |
| 2067 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 23534410 |
| 2068 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 23534410 |
| 2069 | CVSRRRRRRGGRRRR | LMWP | 15 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticles and Fluoriophore (coumarin-6) | 23350619 |
| 2070 | EEEEEEEEEE-PLGLAG-VSRRRRRRGGRRRR | ALWMP | 24 | L | Linear | Synthetic | NA | Free | Free | Linker (PLGLAG) | Nanoparticles and Fluoriophore (coumarin-6) | 23350619 |
| 2071 | HHHHHHESGGGGSPGRRRRRRRRRRR | Foxp3-11R | 26 | L | Linear | Synthetic | NA | Conjugation with 6-histidine tag | NA | Linker (ESGGGGSPG) | Fluorophore (FITC) and protein (monoclonal antibodies) | 23541572 |
| 2072 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2073 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2074 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2075 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2076 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2077 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2078 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2079 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2080 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
| 2081 | CRGDKGPDC | iRGD-CDD | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (Red fluorophor Dy550) | 23248118 |
| 2082 | ARRRAARAARRRAARAARRRAARAARRRAARA | 32 A-R | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2083 | AKKKAAKAAKKKAAKAAKKKAAKAAKKKAAKA | 32 A-K | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2084 | ARRRAARAARRRAARAARRRAARA | 24 A-R | 24 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2085 | AKKKAAKAAKKKAAKAAKKKAAKA | 24 A-K | 24 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2086 | ARRARAARRARAARRARAARRARAARRARA | 30 A-R | 30 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2087 | AKKAKAAKKAKAAKKAKAAKKAKAAKKAKA | 30 A-K | 30 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2088 | RARARARARARARARARARARARARARARARA | 32 RA | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2089 | YGRKKRRQRRR | 6His-TAT-Ainp1 | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Peptide (Ainp1) | 23454269 |
| 2090 | YGRKKRRQRRR | 6His-TAT-GFP | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (eGFP) | 23454269 |
| 2091 | YGRKKRRQRRR | 6xHis-TAT-SOD | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (Cu,Zn-superoxide dismutase) | 23289802 |
| 2092 | YTFGLKTSFNVQ | Ypep-GFP | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2093 | YTFGLKTSFNVQYTFGLKTSFNVQ | Ypep-GFP-Ypep | 24 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2094 | YGRKKRRQRRR | Tat-GFP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2095 | YGRKKRRQRRRYGRKKRRQRRR | Tat-GFP-Tat | 22 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2096 | RQIKIWFQNRRMKWKK | Pen-GFP | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2097 | RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWK | Pen-GFP-Pen | 31 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2098 | CRGDK | CRGDK | 5 | L | Linear | Synthetic | NA | Free | Free | NA | Small molecule drug (Doxorubicin), DSPE- PEG2000 | 23634882 |
| 2101 | RRRRRRRR | GC/R8-Lip | 8 | L | Linear | Synthetic | NA | Stearylation | Free | NA | Protein [GC (-galactosylceramide), ovalbumin] | 23860186 |
| 2102 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23736031 |
| 2103 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23952735 |
| 2121 | YGRKKRRQRRR | TAT | 11 | L | Linear | Protein derived | NA | Free | NA | NA | Small molecule drug (Doxorubicin and Paclitaxel) | 23792465 |
| 2122 | AGYLLGHINLHHLAHLHHILC | TH peptide | 21 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 23891517 |
| 2123 | AGYLLGHINLHHLAHLHHIL | TH peptide | 20 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Nanoparticle (Liposomes) | 23891517 |
| 2124 | AGYLLGKINLKKLAKLLLIL | TK peptide | 20 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Nanoparticle (Liposomes) | 23891517 |
| 2125 | CHHRRRRHHC | CH2 R4 H2 C | 10 | L | Cyclic | Synthetic | NA | Stearylation | Free | NA | Nucleic aciud (siRNA) | 23911914 |
| 2126 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (Insulin) | 24060698 |