| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2010 | YGRKKRRQRRR | Tat-AIE dots | 11 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | TPETPAFN and TPAFN | 23359649 |
| 2017 | GRKKRRQRRRPQ | HIV-1 TAT peptide--Crystallins | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (Human B-Crystallin) | 23150610 |
| 2022 | NYRWRCKNQN | ECP(32-41) | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC), Protein (eGFP) and Peptide (KLA) | 23469189 |
| 2023 | NYQRRCKNQN | EDN(32-41) | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2024 | NYQWRCKNQN | ECP(32-41)R3Q | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2025 | NYRRRCKNQN | ECP(32-41)W4R | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2026 | YRWRCKNQN | ECP(33-41) | 9 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2027 | NYRWRCKNQ | ECP(32-40) | 9 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2028 | YRWRCKNQ | ECP(33-40) | 8 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2029 | NYRWRCKN | ECP(32-39) | 8 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2030 | RWRCKNQN | ECP(34-41) | 8 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2031 | NYRWRCK | ECP(32-38) | 7 | L | Linear | Protein derived | Cationic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2032 | GRKKRRQRRRP | TAT(47-57) | 11 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Fluorophore (FITC) | 23469189 |
| 2039 | LLIILRRRIRKQAHAHSK | FAM-pVEC | 18 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein (FAM)] | 23350661 |
| 2044 | RKKRRQRRRGC | Tat-Cys | 11 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Fluorophore (TMR-5(6)C2- maleimide) | 23322746 |
| 2054 | GRKKRRQRRRG | TAT | 11 | L | Linear | Protein derived | Cationic | Conjugation with carboxytetramethyl rhodamine B | Amidation | NA | Fluorophore (TMR, Alexa fluors and Cy3) | 23278754 |
| 2061 | GGRRARRRRRR | CTP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Peptide (HBcAg18 27-Tapasin) | 23299079 |
| 2089 | YGRKKRRQRRR | 6His-TAT-Ainp1 | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Peptide (Ainp1) | 23454269 |
| 2090 | YGRKKRRQRRR | 6His-TAT-GFP | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (eGFP) | 23454269 |
| 2091 | YGRKKRRQRRR | 6xHis-TAT-SOD | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (Cu,Zn-superoxide dismutase) | 23289802 |
| 2092 | YTFGLKTSFNVQ | Ypep-GFP | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2093 | YTFGLKTSFNVQYTFGLKTSFNVQ | Ypep-GFP-Ypep | 24 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2094 | YGRKKRRQRRR | Tat-GFP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2095 | YGRKKRRQRRRYGRKKRRQRRR | Tat-GFP-Tat | 22 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2096 | RQIKIWFQNRRMKWKK | Pen-GFP | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2097 | RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWK | Pen-GFP-Pen | 31 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2102 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23736031 |
| 2103 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23952735 |
| 2121 | YGRKKRRQRRR | TAT | 11 | L | Linear | Protein derived | NA | Free | NA | NA | Small molecule drug (Doxorubicin and Paclitaxel) | 23792465 |
| 2126 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (Insulin) | 24060698 |
| 2128 | TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT | IL-13p | 36 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (Coumarin-6 and DiR) | 24120853 |
| 2129 | YGRKKRRQRRR | TAT-gelonin | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (gelonin) | 25204286 |
| 2148 | CIGAVLKVLTTGLPALISWIKRKRQQ | Melittin | 26 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2151 | RRRRRRRQIKILFQNRRMKWKKGGC | R6-Pen(W-L) | 25 | L | Linear | Protein derived | Cationic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2161 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2162 | rqikiwfqnrrmkwkk | Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2169 | CGYGRKKRRQRRRGC | TAT | 15 | L | Cyclic | Protein derived | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 24985759 |
| 2170 | VSRRRRRRGGRRRR | C24-LMWP | 14 | L | Linear | Protein derived | Cationic | C24 chain composed of two 12-aminododecanoic acid (ADA) added at N terminal | NA | NA | Nanoparticle (PLGA-NPs) | 25003794 |
| 2171 | GWTLNSAGYLLGKINLKALAALAKKIL | Transportan | 27 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2172 | KLALKLALKALKAALKLA | MAP | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2173 | GRKKRRQRRRPPQ | pTat | 13 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2174 | RQIKIWFQNRRMKWKK | pAntp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2176 | CSSLDEPGRGGFSSESKV | 1A | 18 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2177 | AGYLLGKINLKALAALAKKIL | TP10 | 21 | L | Linear | Protein derived | Amphipathic | Conjugation with Oregon Green 488 | Amidation | NA | Fluorophore (Oregon Green 488) | 25016968 |
| 2178 | KCFQWQRNMRKVRGPPVSCIKR | hLF WT | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2179 | KCFQWQRNMRKVRGPPVSCIKR | hLF W5A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2180 | KCFQWQRNMRKVRGPPVSCIKR | hLF Q6A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2181 | KCFQWQRNMRKVRGPPVSCIKR | hLF M9A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2182 | KCFQWQRNMRKVRGPPVSCIKR | hLF P15A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2183 | KCFQWQRNMRKVRGPPVSCIKR | hLF V12R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |