Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Hydrophobic residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 5622

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb12200	akklohalhoallalohlahollakk	26	69	31	15	0	23
satpdb12201	GLWRALWRLLRSLWRLLWSQPKKKRKV	27	52	44	33	0	19
satpdb12206	FPVTWPTKWWKS	12	58	42	17	0	42
satpdb12207	GLASFLGKALKAGLKIGAHLLGGAPQQ	27	56	26	11	0	48
satpdb12212	VGINYWLAHKHK	12	67	50	17	0	17
satpdb12214	LKLFKKILKFL	11	64	36	36	0	0
satpdb12218	IWSAIWSGIKGLL	13	62	23	8	0	38
satpdb12219	IYEPEIA	7	71	43	0	29	29
satpdb12224	HLKTAVQMAVFIHNFKR	17	59	47	18	0	18
satpdb12225	GLL	3	67	0	0	0	33
satpdb12233	LNWGALLKHLLK	12	67	33	17	0	17
satpdb12238	GLKEIFKAGLGSLVKGIAAHVAS	23	57	30	13	4	43
satpdb12244	GFMKYIKPLIPHAVKAIKKLI	21	67	33	24	0	24
satpdb12246	SLGGKPDLRPCYPPCHYIPRPKPR	24	54	42	21	4	50
satpdb12247	Y(A)GAVVNDL	11	55	27	0	9	27
satpdb12248	LFRLIKSLIKRLVSAFK	17	59	41	29	0	18
satpdb12251	DLPMHPM	7	57	29	0	14	29
satpdb12254	TAYFLAKLAGRW	12	67	33	17	0	42
satpdb12257	FLPLVRVAAKLIPSVVCAISKRC	23	65	26	17	0	39
satpdb12258	VKLKVyPLKvKLyP	14	71	43	29	0	14
satpdb12260	TTWEAWDRAIAEYAARIEALIRAAQEQQEK LEAALREL	38	53	50	13	21	32
satpdb12261	SADLVKKIWDNPAL	14	57	43	14	14	29
satpdb12263	HALWMTLLKKVLKAAAKAALNAVLVGANA	29	69	28	14	0	38
satpdb12266	RFRLPFRRPPIRIHPPPFYPPFRRFL	26	73	35	27	0	31
satpdb12267	WVPAFCQAVGWGDPITHWSH	20	65	30	0	5	45
satpdb12272	PITNF	5	60	40	0	0	40
satpdb12280	AVDPRMFYLLLRGGA	15	60	27	13	7	33
satpdb12281	KKKKVVAATYVLA	13	62	46	31	0	31
satpdb12284	SKVLYYNWE	9	56	67	11	11	11
satpdb12286	ILPFKFPFPFRR	12	75	25	25	0	25
satpdb12287	LLIILARRIRKQAHAHSK	18	61	50	28	0	22
satpdb12289	LNWGAALKHAAK	12	67	33	17	0	42
satpdb12292	ELKNEAVRHFPRIWL	15	60	47	20	13	13
satpdb12295	ILGPVLSMVGSALGGLIKKI	20	55	20	10	0	40
satpdb12303	YSINDWH	7	57	71	0	14	14
satpdb12304	AGERIVDIIA	10	60	30	10	20	30
satpdb12306	KWKLFKKIGAVLKVL	15	60	33	33	0	13
satpdb12310	NSHAIYP	7	71	57	0	0	43
satpdb12313	IINWCCLIFYQCCL	14	57	21	0	0	29
satpdb12319	RWKIFKKIEKVGRNVRDGIIKAGPAVAVVG QAATVVK	37	51	38	24	5	30
satpdb12320	ILGKILEGIKSLF	13	54	31	15	8	23
satpdb12321	FAKRYVELVIVA	12	75	33	17	8	17
satpdb12323	VPTLE	5	60	40	0	20	40
satpdb12325	GIGGVLPSAGKAALKGLAKVLAEKYAN	27	56	30	15	4	48
satpdb12331	ILGTILGLLKGL	12	58	17	8	0	33
satpdb12332	NLYYASW	7	71	57	0	0	29
satpdb12333	ILQKAVLDCLKAAGSSLSKAAITAIYNKIT	30	53	43	13	3	43
satpdb12335	LKKLAKLALAF	11	73	27	27	0	27
satpdb12337	FFLSRIFGK	9	56	33	22	0	22
satpdb12342	FLPLLAGLAANFLPKIFCKITRKC	24	63	25	17	0	38

entries from 651 - 700