Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Small sized residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 4953

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb13479	RQIKIWFQNRRMKWKA	16	38	56	38	0	6
satpdb13480	KNWKAILKHIIK	12	58	50	33	0	8
satpdb13488	VRPYLVAF	8	88	25	13	0	25
satpdb13492	KKKKVVEATYVLV	13	54	54	31	8	15
satpdb13495	MIIFRIAATHKK	12	58	42	25	0	25
satpdb13498	YTSLIHSLIEEPQNQQEKNEQELLELDKWA SLWNWF	36	44	61	6	19	17
satpdb13499	WKKW-Dip-KKWK	13	38	46	38	8	8
satpdb13505	LDSLSFSYNNFEEDD	15	33	73	0	33	20
satpdb13507	LQKW	4	50	50	25	0	0
satpdb13509	FKIKPGKVLDKFGKIVGKVLKQLKKVS	27	44	44	33	4	19
satpdb13517	LLRVKR	6	50	50	50	0	0
satpdb13519	VNWKKLLGKLLKVVK	15	53	40	33	0	7
satpdb13522	KQRNRWEWRPDFKSKKVKISLPC	23	35	61	35	9	22
satpdb13523	VV-Chg-N-Fum-GGF	16	31	13	0	0	25
satpdb13524	ELYVSRL	7	57	57	14	14	14
satpdb13526	QKKIRFRLSA	10	40	60	40	0	20
satpdb13527	ILPILGNLLNSLL	13	69	23	0	0	23
satpdb13528	LLIILRRRIRKQAAAHSK	18	56	50	33	0	22
satpdb13534	IAWCELQNHELTLWN	15	53	47	0	13	20
satpdb13536	RVIEVVQGACRAIRHIPRRIRQGLERIL	28	50	43	25	7	21
satpdb13538	VKRKKKPALWKTLLKKVLKA	20	50	50	45	0	20
satpdb13539	MY	2	50	50	0	0	0
satpdb13545	MLQDWLSSLGDLLKSLLDTVNKFTKK	26	38	54	15	12	23
satpdb13546	YTAIAWVKAFIRKLRK	16	63	44	31	0	25
satpdb13547	DDLHPFNENNMYYGCKGLSNSNKFED	26	31	65	8	19	23
satpdb13548	VKHWPW	6	83	33	17	0	17
satpdb13566	AFGMALKLLKKVL	13	62	23	23	0	23
satpdb13581	LTFSDWWKLLAE	12	58	42	8	17	25
satpdb13585	RIVWVRIRRWFV	12	67	33	33	0	0
satpdb13588	LRPAILVRIK	10	70	30	30	0	20
satpdb13597	SNDIYFNFQR	10	40	70	10	10	10
satpdb13619	KILRGVSKKIMRTFLRRILTGKK	23	35	52	39	0	22
satpdb13632	Nle-Lys-N-Me-Arg-Arg-H	22	27	41	9	9	23
satpdb13640	ILPKKKPWWPWRR	13	62	38	38	0	23
satpdb13644	MYNCSLQNGFTMKVDDLIVH	20	40	50	5	10	20
satpdb13645	KKRRQRRR	8	0	100	88	0	0
satpdb13652	HFYLRDEDWVDCCQMGDCCDE	21	29	52	5	33	24
satpdb13654	crkkrrqrrr	10	0	90	80	0	10
satpdb13657	MRWRD	5	20	60	40	20	0
satpdb13660	GLLNGLALRLGKRALKKIIKRLCR	24	46	38	33	0	25
satpdb13666	LDPIDISIELNKAKSDLEESKEWIRRSNQK LDSI	34	35	65	18	24	21
satpdb13667	KKKKKKKKKKGIGKFLHSAKKFGKAFVGEI MNS	33	30	58	42	3	24
satpdb13678	LLIILRRRIARKQAHAHSK	19	58	53	32	0	21
satpdb13682	GRFKRFRKKFKKLFKKLSPVIPLLHL	26	54	46	38	0	15
satpdb13685	VKLkVyPLKVKLyP	14	71	43	29	0	14
satpdb13688	FAKLLAKLAKKIL	13	69	31	31	0	23
satpdb13693	YRPY	4	75	75	25	0	25
satpdb13702	LL	2	100	0	0	0	0
satpdb13705	LKLGTLVNLAKKIL	14	57	36	21	0	21
satpdb13708	LPFEH	5	80	40	0	20	20

entries from 901 - 950