This page list all the peptide entries having a specific function/subfunction specified by the user in the previous page. The query made by the user is also displayed for convenience. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum number of functions (column 'NF') then he/she needs to sort 'NF' column by cliking on 'NF' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).
Query Function: antibacterial
S-ID: Sequence ID; Seq: Sequence; NF:Number of Functions; FC:Functional category; SF:Sub-functional category; AI: Additional Information; PD:Present in databases;
The total number of entries retured by search is 3011S-ID | Seq | NF | FC | SF | AI | PD |
---|---|---|---|---|---|---|
satpdb18980 | EGPVGLADPDGPASAPLGAP | 3 | antibacterial, antimicrobial, antifungal, | NA | NA, | apd2, camp |
satpdb18983 | KWKLFKKIEKVGQGIGAVLKVLTTGL | 4 | antibacterial, antiparasitic, toxic, antimicrobial, | antiplasmodial, hemolytic | antibiotic, | hemolytik, parapep |
satpdb18985 | ILPLLLGKVVCAITKKC | 2 | antibacterial, antimicrobial, | anti-gram+, anti-gram- | NA, | apd2, camp, dadp, yadamp |
satpdb18988 | SFLDTLKNLAISAAKGAGQSVLSTLSCKLS ETC | 3 | antibacterial, antimicrobial, antifungal, | anti-gram+, anti-gram- | NA, | apd2, camp, dadp, yadamp |
satpdb18990 | KLALklALKALKAALKLA | 3 | antibacterial, toxic, antimicrobial, | hemolytic | NA, | hemolytik |
satpdb18996 | FISAIASMLGKF | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19009 | GLLGVLGSVAKHVLPHVVPVIAEHL | 3 | antibacterial, antiviral, antimicrobial, | anti-gram+, anti-gram- | NA, | apd2, dadp |
satpdb19010 | IIGPVLGMVGSALGGLLKKIG | 2 | antibacterial, antimicrobial, | NA | NA, | camp, yadamp |
satpdb19011 | FIITGLVRGLTKLF | 2 | antibacterial, antimicrobial, | anti-gram- | NA, | apd2, dadp |
satpdb19017 | DPQTDCQQCQRRCRQQESGPRQQQYCQRRC KEICEEEEEYN | 3 | antibacterial, antimicrobial, antifungal, | NA | NA, | phytamp |
satpdb19038 | YPGPQAKEDSEGPSQGPASREK | 3 | antibacterial, cell-cell communication, antimicrobial, | NA | NA, | camp, neuropedia, yadamp |
satpdb19041 | FFSLIPSLVGGLISAFK | 5 | anticancer, antibacterial, toxic, antimicrobial, antifungal, | anti-gram+, cytotoxic | NA, | apd2 |
satpdb19042 | FLPLVTGLLSGL | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19044 | FLPILASLAATLGPKLLCLITKKC | 3 | antibacterial, antimicrobial, antifungal, | anti-gram+ | NA, | apd2, camp, dadp, yadamp |
satpdb19050 | FDIMGLIKKVAGA | 3 | antibacterial, antimicrobial, antifungal, | NA | NA, | camp |
satpdb19051 | GIHDILKYGKPS | 4 | antibacterial, toxic, antimicrobial, antifungal, | hemolytic, anti-gram+, anti-gram- | NA, | apd2, camp, hemolytik, yadamp |
satpdb19054 | KYYGNGLSCSKKGCTVNWGQAFSCGVNRVA TAGHGK | 2 | antibacterial, antimicrobial, | NA | NA, | bactibase |
satpdb19056 | YGQSTHAVIYAQGYTYSSDWR | 2 | antibacterial, antimicrobial, | anti-gram+, anti-gram- | NA, | apd2, camp |
satpdb19069 | GRFRRLRKKTRKRLKKIGKVLKWIPPIVGS IPLGCG | 2 | antibacterial, antimicrobial, | NA | NA, | camp, yadamp |
satpdb19074 | MVSVSVAVQLMLGFGTFVLMLLGLVVELIK NSNKK | 3 | antibacterial, toxic, antimicrobial, | hemolytic | NA, | hemolytik |
satpdb19085 | KKKKKKKKKKGIGKLFLHAAKKFAKAFVAE KMNS | 3 | antibacterial, toxic, antimicrobial, | hemolytic | NA, | hemolytik |
satpdb19087 | INWKKIAEIGKQVLSA | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19100 | K-Ψ[CH | 3 | antibacterial, toxic, antimicrobial, | hemolytic | NA, | hemolytik |
satpdb19106 | VTSWSLCTPGCTSPGGGSNCSFCC | 2 | antibacterial, antimicrobial, | NA | NA, | bactibase, camp, yadamp |
satpdb19115 | FLPLFASLIGKL | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19121 | RLYRKVYG | 4 | antibacterial, toxic, antimicrobial, antifungal, | hemolytic | NA, | hemolytik |
satpdb19150 | GFWTTAAEGLKKFAKAGLASILNPK | 2 | antibacterial, antimicrobial, | anti-gram- | NA, | apd2 |
satpdb19153 | FKLGSFLKKAWKSKLAKKLRAKGKEMLKDY AKGLLEGGSEEVPGQ | 4 | antibacterial, toxic, antimicrobial, antifungal, | hemolytic, anti-gram+, cytotoxic, anti-gram- | NA, | apd2, camp, hemolytik, yadamp |
satpdb19156 | KWKLFKKIGIGAVLKVLKKG | 3 | anticancer, antibacterial, antimicrobial, | NA | NA, | cancerppd |
satpdb19158 | VSCDFEEANEDAVCQEHCLPKGYTYGICVS HTCSCIYIVELIKWYTNTYT | 2 | antibacterial, antimicrobial, | anti-gram+, anti-gram- | NA, | apd2 |
satpdb19162 | FLSLIPHIVSGVAALAKH | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19164 | LRRLWLRANRL | 3 | antibacterial, toxic, antimicrobial, | hemolytic | NA, | hemolytik |
satpdb19191 | FFPLLFGALSSMMPKLF | 3 | antibacterial, antimicrobial, antifungal, | anti-gram+, anti-gram- | NA, | apd2 |
satpdb19193 | FLGGLLASLLGKI | 3 | antibacterial, antimicrobial, antifungal, | anti-gram+, anti-gram- | NA, | apd2, camp |
satpdb19194 | KIKIPWGKVKDFLVGGMKAV | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19211 | GLFDIIKKVASVIGG | 2 | antibacterial, antimicrobial, | NA | NA, | camp |
satpdb19218 | SLGGVISGAKKVAKVAIPIGKAVLPVVAKL VG | 3 | antibacterial, toxic, antimicrobial, | hemolytic, anti-gram+, cytotoxic, anti-gram- | NA, | apd2, camp, hemolytik, yadamp |
satpdb19230 | GGLRSLGRKILRAWKKYG | 3 | antibacterial, antimicrobial, antifungal, | NA | NA, | camp, yadamp |
satpdb19231 | GWLRDFGKRIERVGQHTRDATIQAIGVAQQ AANVAATVRG | 2 | antibacterial, antimicrobial, | anti-gram- | NA, | apd2 |
satpdb19233 | ANDPQCLYGNVAAKF | 4 | antibacterial, antiviral, antimicrobial, antifungal, | NA | NA, | camp, yadamp |
satpdb19240 | GETFDKLKEKLKTFYQKLVEKAEDLKGDLK AKLS | 3 | antibacterial, antimicrobial, antifungal, | NA | NA, | apd2, camp, yadamp |
satpdb19241 | ALKAALLAILKIVRVIKK | 2 | antibacterial, antimicrobial, | NA | NA, | camp, yadamp |
satpdb19242 | FLPPSPWKETFRTS | 3 | antibacterial, antimicrobial, antifungal, | NA | NA, | apd2, camp, dadp, yadamp |
satpdb19245 | TPALAVVTTVLPAAAVTTAKSV | 3 | antibacterial, antimicrobial, antifungal, | anti-gram+ | NA, | apd2, camp |
satpdb19254 | FLPLFASLIGKLL | 2 | antibacterial, antimicrobial, | anti-gram+ | NA, | apd2, dadp |
satpdb19257 | FIGGIISFIKKLF | 2 | antibacterial, antimicrobial, | NA | NA, | camp, yadamp |
satpdb19278 | AWASFFKKAAHVAKHVAKAALTHYL | 3 | antibacterial, toxic, antimicrobial, | hemolytic | NA, | hemolytik |
satpdb19282 | AIKLVQSPNGNFAASFVLDGTKWIFKSKYY DSSKGYWVGIYEVWDRK | 2 | antibacterial, antimicrobial, | anti-gram+, anti-gram- | NA, | apd2, bactibase, camp, yadamp |
satpdb19292 | GFWSSALEGLKKFAKGGLEALTNPK | 2 | antibacterial, antimicrobial, | anti-gram- | NA, | apd2, dadp, yadamp |
satpdb19316 | YDLSKNCRLRGGICYIGKCPRRFFRSGSCS RGNVCCLRFG | 3 | antibacterial, antimicrobial, antifungal, | anti-gram+, anti-gram- | NA, | apd2, camp, yadamp |