Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Small sized residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 4953

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb20279	PQNRLQIRRHSK	12	33	75	33	0	17
satpdb20283	TFWWHPNYYVDW	12	75	50	0	8	17
satpdb20286	DEVVPboroAlg-OH	15	40	27	7	13	20
satpdb20294	GLEEELETVELVEELQQA	18	39	56	0	39	17
satpdb20295	KKLFkkilkyl	11	55	55	45	0	0
satpdb20301	KKKKVVAATKVLV	13	54	46	38	0	23
satpdb20309	RRWWRF	6	50	50	50	0	0
satpdb20313	LRLKSIVSYAKKVL	14	57	50	29	0	21
satpdb20315	GRFKRFRKKFKKLFK	15	33	60	60	0	7
satpdb20317	NNWNN	5	20	80	0	0	0
satpdb20333	GFGMALKLLKKVL	13	54	23	23	0	23
satpdb20335	KFAR	4	50	50	50	0	25
satpdb20336	GKWMSLLKHILK	12	50	42	25	0	17
satpdb20337	(D)INCDFLL	10	40	30	0	20	10
satpdb20338	ALWKTLLKKVLKA	13	62	38	31	0	23
satpdb20347	MIIYRALIS	9	67	33	11	0	22
satpdb20349	AHLL	4	100	25	0	0	25
satpdb20351	ILPKKWPKLPWRR	13	62	38	38	0	23
satpdb20360	WQEPAYQRFL	10	60	50	10	10	20
satpdb20362	KKKKLVLPFLLFF	13	69	31	31	0	8
satpdb20363	VRRFAWWWAFLRR	13	69	31	31	0	15
satpdb20365	KDKMKAGWER	10	20	60	40	20	20
satpdb20374	VKNDT	5	20	80	20	20	20
satpdb20380	RQIKIWFPNRRMKWKK	16	38	56	44	0	6
satpdb20388	rrrqrrkkr	9	0	100	89	0	0
satpdb20391	MDVNPFLLFLKVPAQ	15	67	27	7	7	20
satpdb20394	VALDPIDISIELNKAKSDLEESKEWIRR	28	43	57	18	25	21
satpdb20396	RDWERREFERRQNELRREQEQRREELL	27	19	81	33	33	0
satpdb20397	SRWRDVARNFMRRYQSRVIQGLVA	24	42	54	25	4	21
satpdb20402	QTKDLQQKFYEIIMDIEQNNVQGKKGIQQL QKWED	35	29	66	14	17	9
satpdb20410	NFLGTLVNLAKKIL	14	57	36	14	0	21
satpdb20419	KKFPWWWPFKK	11	64	36	36	0	18
satpdb20424	ILPWKKPKLPWRR	13	62	38	38	0	23
satpdb20426	GINTLKKVIQGLHEVIKLVSNHE	23	48	52	13	9	17
satpdb20428	LIILVPPFf	9	100	0	0	0	22
satpdb20429	LV	2	100	0	0	0	0
satpdb20433	QRRNQLHDLRFADID	15	40	67	20	20	7
satpdb20438	IGVIKLSLCEEERNADEEKRRDDPDEMDVE VEKR	34	26	65	21	38	15
satpdb20441	Myristoleoyl-Aib-Hyp-LVQL-OMe	29	45	34	3	7	14
satpdb20444	VFQFLGKIIHHVGNFVHGFSHVF	23	70	35	4	0	17
satpdb20448	KKLFKKILKFL	11	55	45	45	0	0
satpdb20450	LKLLKWLLKLL	11	73	27	27	0	0
satpdb20451	KVFKRLEKLFSKIQNDK	17	35	65	35	12	6
satpdb20454	RRHWCW	6	50	50	33	0	17
satpdb20457	KIMAKPSKFYEQLRGR	16	38	56	31	6	25
satpdb20473	RVVRQWPIGRVVRRVVRRVVR	21	52	43	38	0	10
satpdb20475	RKKRRQRRR	9	0	100	89	0	0
satpdb20477	MLDW(Geranyl)KY	15	40	47	13	13	13
satpdb20478	LEQL	4	50	50	0	25	0
satpdb20481	KKKKLLLPFYFFV	13	69	38	31	0	8

entries from 2651 - 2700