This page list peptide entries which have other functions or activity which are not categorized in main function/sub-function categories due to their small number. These entries are therefore displayed in additional information section. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum number of functions (column 'NF') then he/she needs to sort 'NF' column by cliking on 'NF' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).
S-ID: Sequence ID; Seq: Sequence; NF:Number of Functions; FC:Functional category; SF:Sub-functional category; AI: Additional Information; PD:Present in databases;
The total number of entries retured by search is 3S-ID | Seq | NF | FC | SF | AI | PD |
---|---|---|---|---|---|---|
satpdb11124 | CGESCVFIPCISTLLGCSCKNKVCYRNGVI P | 3 | antiviral, toxic, antimicrobial, | hemolytic | uterotonic, | hemolytik |
satpdb13102 | SAISCGETCFKFKCYTPRCSCSYPVCK | 3 | antiviral, toxic, antimicrobial, | hemolytic, cytotoxic | uterotonic, insecticidal, anti-neurotensive, | hemolytik |
satpdb19037 | CGETCVGGTCNTPGCTCSWPVCTRNGLPV | 4 | anticancer, antiviral, toxic, antimicrobial, | hemolytic | uterotonic, | hemolytik |