Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Small sized residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 4953

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb12293	HDWTKNITDKIDQIIHDFVDKTLPD	25	44	64	12	24	16
satpdb12294	KKR	3	0	100	100	0	0
satpdb12302	GMWSKILGKLIR	12	42	33	25	0	25
satpdb12303	YSINDWH	7	57	71	0	14	14
satpdb12306	KWKLFKKIGAVLKVL	15	60	33	33	0	13
satpdb12315	LKWLLKWLL	9	78	22	22	0	0
satpdb12320	ILGKILEGIKSLF	13	54	31	15	8	23
satpdb12321	FAKRYVELVIVA	12	75	33	17	8	17
satpdb12329	KWKKLLKKPLLKKLLKKL	18	50	50	50	0	6
satpdb12337	FFLSRIFGK	9	56	33	22	0	22
satpdb12341	TSLIHSLIEESQNQQEKNEQELLELDKWAS LWNWFN	36	39	64	6	19	17
satpdb12346	GRLKRLRKKLKKLLKKLS	18	33	61	56	0	11
satpdb12359	IQY	3	67	67	0	0	0
satpdb12364	LIQP	4	75	25	0	0	25
satpdb12367	RIVWVRIRRLQV	12	58	42	33	0	0
satpdb12369	FLPLILRKIVTA	12	75	25	17	0	25
satpdb12379	KWKWKW	6	50	50	50	0	0
satpdb12383	VIGGDECNINEHRFLAALYD	20	50	45	5	20	25
satpdb12390	DEMEEC	6	0	67	0	67	17
satpdb12391	VAHINVWK	8	75	38	13	0	13
satpdb12392	LVRDSMAKLRERLNQRQKLFESTQ	24	29	67	25	13	17
satpdb12397	Nle-Lys-Arg-Lys-H	17	41	47	6	6	24
satpdb12406	KWFKKIPKFLHLAKKF	16	63	44	38	0	13
satpdb12413	EDENNPFYLR	10	40	70	10	30	10
satpdb12419	GLRQKVQSLV	10	40	50	20	0	20
satpdb12429	GLFAVIKKVAAVIKKL	16	69	25	25	0	25
satpdb12444	RLSGMNEVLSFRWL	14	43	43	14	7	21
satpdb12447	MLQDLLSSLGDLLKSWLDTLNKFTKK	26	38	54	15	12	23
satpdb12450	KMDSRWRWKCCKK	13	15	62	46	8	23
satpdb12454	RIKRFWPVVIRT	12	58	42	33	0	17
satpdb12456	KWEYVLLLFLL	11	82	27	9	9	0
satpdb12457	WMEWDREINNYTSLIHSLIEELQNQQEKNE QELL	34	35	68	6	24	9
satpdb12465	LKLFKKILKYL	11	64	45	36	0	0
satpdb12466	FVDLKKIANIINSIFGK	17	53	41	18	6	18
satpdb12471	KLKLLLLL	8	75	25	25	0	0
satpdb12472	REINNYTSLIHSLIEESQNQQEKNEQELLE LDKWAS	36	33	72	8	22	17
satpdb12474	RQIAIWFQNRRMKWKK	16	38	56	38	0	6
satpdb12475	NRLARHFRDIAGRVNQRL	18	44	56	28	6	17
satpdb12476	Phenylpropionyl-K-R-R-H	23	43	48	17	4	13
satpdb12482	KCFQWQRNMRKVR	13	23	62	38	0	8
satpdb12489	MTKWQEVDEMLRSEY	15	27	67	13	27	13
satpdb12492	FFF	3	100	0	0	0	0
satpdb12494	EVLNENLLRF	10	50	50	10	20	0
satpdb12509	LLGDFFRKSKEKIGKEFKRIVQR	23	35	57	35	13	13
satpdb12512	KWKSFIKKLTDKFLHSAKKF	20	45	60	35	5	20
satpdb12515	VNWKKILGKIIKVAK	15	53	40	33	0	13
satpdb12517	VOLFPWFNQY	10	70	30	0	0	10
satpdb12518	RWFRIQLQIRRWRNRR	16	38	63	44	0	0
satpdb12519	KKKFPWWWPFKKKCKKKFPWWWPFKKKC	28	50	43	43	0	21
satpdb12523	SWLRDLWDWICELLSDFK	18	50	44	11	22	17

entries from 601 - 650