This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb10148. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb10148 |
| Sequence | FECSISCEIEKKGESCKPKKCKGGWKCKFNMCVKV |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 1 (toxinpred) |
| Link to Source | toxinpred_869, |
| Major Functions | 1 (toxic,) |
| Sub-functions | cytotoxic |
| Additional Info | NA, |
| Helix (%) | 0 |
| Strand (%) | 17.1 |
| Coil (%) | 37.1 |
| Turn (%) | 45.7 |
| DSSP states | CCCCSCSSSSSSCSSCCCSSCCTTEEECSSSEEEC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (Homology based) |