This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb10170. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb10170 |
| Sequence | KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISAST |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Not Available |
| Type of Modification | None |
| Source (Databases) | 1 (cancerppd) |
| Link to Source | cancerppd_4444, |
| Major Functions | 3 (anticancer, antibacterial, antimicrobial,) |
| Sub-functions | NA |
| Additional Info | NA, |
| Helix (%) | NA |
| Strand (%) | NA |
| Coil (%) | NA |
| Turn (%) | NA |
| DSSP states | NA |
| 3-D Structure | Not Predicted |