This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb10557. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb10557 |
| Sequence | SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 2 (apd2, yadamp) |
| Link to Source | apd2_AP00234, yadamp_1903, |
| Major Functions | 4 (antibacterial, toxic, antimicrobial, antifungal,) |
| Sub-functions | anti-gram+, cytotoxic, anti-gram- |
| Additional Info | NA, |
| Helix (%) | 76.6 |
| Strand (%) | 0 |
| Coil (%) | 10.6 |
| Turn (%) | 12.8 |
| DSSP states | CGGGSSCHHHHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHTSSCC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (I-TASSER) |