This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb10864. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb10864 |
| Sequence | GIPCGESCVFIPCLTTVAGCSCKNKVCYRN |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 3 (camp, phytamp, yadamp) |
| Link to Source | camp_CAMPSQ767, phytamp_PHYT00187, yadamp_1214, |
| Major Functions | 2 (antiviral, antimicrobial,) |
| Sub-functions | NA |
| Additional Info | NA, |
| Helix (%) | 13.3 |
| Strand (%) | 0 |
| Coil (%) | 60 |
| Turn (%) | 26.7 |
| DSSP states | CCCCSCCSSCTTSCCCSHHHHCCCCCSCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (PEPstrMOD) |